Results for week 1 Dr Mike Dyall-Smith
|
|
- Amy Wells
- 6 years ago
- Views:
Transcription
1 Lecture 2. emm sequence typing of GAS Results for week 1 Dr Mike Dyall-Smith Review of week 1 results Why (sero)group and (sero)type streptococci? Typing schemes: M, SOF, T antigens emm sequence typing Beall et al. paper (1996) Classical microbiological identification All isolates were: Grow in air (aerotolerant not aerobic) Gram +ve cocci, forming chains, size (?) haemolytic on HBA Catalase -ve Lancefield Group A (Streptex test) Bacitracin sensitive Penicillin sensitive (others?) Throat swab plate Identification of streptococci using phenotypic tests Gram stain Genus level Species level Mucoid GAS strain Antibiotic Sensitivity Tests Bacitracin resistant Group G Streptococcus sp. Sensitive to all antibiotics Set Up Isolates showing resistance to erythromycin and tetracycline 1
2 Lancefield Grouping Tests Why serogroup streptococci? Group A Group G Lancefield grouping was to aid identification Easy, quick test (e.g. Streptex ) Correlates well with species definitions for GAS and GBS (not so well with others) Know structure and location of A antigen In almost all cases the presence of group A antigen corresponds to S. pyogenes. Identification of streptococci using phenotypic tests Genus level Species level Why serotype streptococci? S. pyogenes isolates all belong to Lancefield Group A, but can be further classified into > 100 M-TYPES on the basis on their different M proteins. The method was developed to aid epidemiology, research, and vaccine efforts. Can you associate M-types with diseases? How do you track outbreaks? Antibodies to M protein are protective. M-SEROTYPING of S. pyogenes Classical M-serotyping (M-typing) Before DNA sequencing, M proteins were typed using antibodies. How was this done? Take cells from plate/broth culture Make crude extract of surface material by heating at low ph. Inject into animals to obtain an antiserum Antigen Cross-absorb antiserum to remove crossreactive antibodies. Do precipitation tests by adding cell wall extract and antiserum. Need many different antisera (>100). Ab + Ag 2
3 Classical M-serotyping (M-typing) Ab to strain 1 Ab to strain 2 Ab to strain 3 Ab to strain Strains 1,2,3 are different serotypes. Strains 3,4 are the same serotype. Ag Ab + - Ag Ab Classical M-serotyping (M-typing) ** PROBLEMS ** 1. Cross-reactions! because the antigen is a crude mixture of cell wall molecules, not pure M- proteins. 2. Many serotypes, so need to prepare >100 different antisera, absorb out cross-reacting antibodies from each, and test they are specific. 3. Many strains are M-untypable, ie. Do NOT react with any of the antisera! (particularly sof+) M-like M T sof Classical M-serotyping: was there a better way?? M protein ** PROBLEMS ** While it was possible to M-serotype S.pyogenes isolates, there were no commercially available kits or antibodies. You either made them yourself (very expensive!) or asked a reference centre to give you some (not likely). They didn t cover all the known types. Even if you had most of the typing sera, many were often of weak strength (titre) or showed cross-reactions, or didn t react with certain isolates (M-nontypeable strains) M-like M T sof Type-specific Ab Cross-reactive Ab M-SEROTYPING: a better way?? People looked for a better way to type the M proteins of S. pyogenes One idea was to use PCR amplification and DNA sequencing of the emm gene. But would the known M-serotypes match the sequence-types predicted by DNA sequencing? And how do you define new emm types? M protein - a long way to the top.. M protein is synthesized inside the cell Ends up right on the outside surface Covalently attached at C-terminus to cell wall Highly structured (long, helical filament) DNA sequence does not directly reflect the mature protein. 3
4 Synthesis, export and maturation of M protein N-terminal signal sequence: transport through general secretory pathway (Sec) virr emm5 enn5 scpa 5 3 mrna Overview N-terminus NH3- N-terminal signal peptide removed M-protein Export from cell C-terminus COOH C-terminus modified and attached to cell wall DETAIL Leader peptidase Economou, TIM 1999 N-terminal signal sequence: transport through general secretory pathway (Sec) N-terminal signal sequence: transport through general secretory pathway (Sec) Signal sequence underlined: cleavage b/n aa 41 & 42 >M protein type 1 S. pyogenes 484aa MAKNNTNRHYSLRKLKTGTASVAVALTVLGAGFANQTEVKA/NGDGNPREVIED LAANNPAIQNIRLRYENKDLKARLENAMEVAGRDFKRAEELEKAKQALEDQRKD LETKLKELQQDYDLAKESTSWDRQRLEKELEEKKEALELAIDQASRDYHRATAL EKELEEKKKALELAIDQASQDYNRANVLEKELETITREQEINRNLLGNAKLELD QLSSEKEQLTIEKAKLEEEKQISDASRQSLRRDLDASREAKKQVEKDLANLTAE LDKVKEDKQISDASRQGLRRDLDASREAKKQVEKDLANLTAELDKVKEEKQISD ASRQGLRRDLDASREAKKQVEKALEEANSKLAALEKLNKELEESKKLTEKEKAE LQAKLEAEAKALKEQLAKQAEELAKLRAGKASDSQTPDTKPGNKAVPGKGQAPQ AGTKPNQNKAPMKETKRQLPSTGETANPFFTAAALTVMATAGVAAVVKRKEEN Economou, TIM 1999 C-terminal LPXTG signal: cell wall attachment M-protein C-terminal Anchor to Cell Surface: role of LPXTG signal >NP_ M protein type 1 S. pyogenes, 484 aa MAKNNTNRHYSLRKLKTGTASVAVALTVLGAGFANQTEVKA/NGDGNPREVIED LAANNPAIQNIRLRYENKDLKARLENAMEVAGRDFKRAEELEKAKQALEDQRKD LETKLKELQQDYDLAKESTSWDRQRLEKELEEKKEALELAIDQASRDYHRATAL EKELEEKKKALELAIDQASQDYNRANVLEKELETITREQEINRNLLGNAKLELD QLSSEKEQLTIEKAKLEEEKQISDASRQSLRRDLDASREAKKQVEKDLANLTAE LDKVKEDKQISDASRQGLRRDLDASREAKKQVEKDLANLTAELDKVKEEKQISD ASRQGLRRDLDASREAKKQVEKALEEANSKLAALEKLNKELEESKKLTEKEKAE LQAKLEAEAKALKEQLAKQAEELAKLRAGKASDSQTPDTKPGNKAVPGKGQAPQ AGTKPNQNKAPMKETKRQLPSTGETANPFFTAAALTVMATAGVAAVVKRKEEN LPXTG signal Hydrophobic aa form a lipid anchor Navarre &Schneewind, Microbiol. Molec. Biol. Rev (1999) 63:
5 M protein 60 nm emm gene sequence typing DNA sequence from the 5 end (of coding strand) N-terminus NH3-5 3 emm gene Transcription > translation M-protein COOH JOURNAL OF CLINICAL MICROBIOLOGY, Apr. 1996, p Vol. 34, No. 4 Sequencing emm-specific PCR Products for Routine and Accurate Typing of Group A Streptococci SUMMARY BERNARD BEALL, RICHARD FACKLAM, and TERRY THOMPSON 1. emm gene sequencing is an alternative to M-serotyping of GAS 2. Members of the same M-serotype almost always belonged to the same emm-sequence type 3. Six more emm genes were sequenced (increasing the emm sequence-type database) 4. Could now sequence-type the M-nontypeable strains. Variable region at N-terminus conserved C-terminus anchored in cell wall 5. Successfully used sequence typing to track an outbreak of GAS infections in a hospital (single-source). emm gene sequence typing. - CDC definition of an emm type P1 emm gene Old Definition: Greater than or equal to 95% nt identity over the first 160 bases of sequence (using primer 1) with that of a reference emm gene sequence. NEW DEFINITION: New types share less than 92% sequence identity over the first 90 bases encoding the deduced processed M protein of the type reference strain emm gene sequence typing 5 end of gene: TGAGGGTTTTTCCTAAAAAATGATAACATAAGGAGCATAAAA ATG GCT AGA GAA M A R E AAT ACC AAT AAG CAT TAT TGG CTT AGA AAA TTA AAA AAA GGC ACT G... N T N K H Y W L R K L K K G T... *Primer EMM1 (forward) sequence is underlined. Start codon of M protein is in bold. Forward PCR primer EMM1 is within the region of the gene corresponding to the N-terminal Signal Sequence 5
6 emm gene sequence typing Consensus DNA primer sites relative to M protein sequence of emm gene 3 end of the gene: CAA TTA GCA AAA CAA GCT GAA GAA CTT GCA AAA CTA AGA GCT GGA......Q L A K Q A E E L A K L R A G... *Region of primer EMM2 is underlined. The actual sequence of the primer is the reverse and complement of this (see table on previous page). Stop codon for M protein ORF is further downstream at Reverse PCR primer EMM2 is within the region of the gene corresponding to the C-terminal C-repeats, but before the LPXTG signal sequence. >NP_ M protein type 1 S. pyogenes, 484 aa MAKNNTNRHYSLRKLKTGTASVAVALTVLGAGFANQTEVKA/NGDGNPREVIED LAANNPAIQNIRLRYENKDLKARLENAMEVAGRDFKRAEELEKAKQALEDQRKD LETKLKELQQDYDLAKESTSWDRQRLEKELEEKKEALELAIDQASRDYHRATAL EKELEEKKKALELAIDQASQDYNRANVLEKELETITREQEINRNLLGNAKLELD QLSSEKEQLTIEKAKLEEEKQISDASRQSLRRDLDASREAKKQVEKDLANLTAE LDKVKEDKQISDASRQGLRRDLDASREAKKQVEKDLANLTAELDKVKEEKQISD ASRQGLRRDLDASREAKKQVEKALEEANSKLAALEKLNKELEESKKLTEKEKAE LQAKLEAEAKALKEQLAKQAEELAKLRAGKASDSQTPDTKPGNKAVPGKGQAPQ AGTKPNQNKAPMKETKRQLPSTGETANPFFTAAALTVMATAGVAAVVKRKEEN First part of study: For 62 of the 75 isolates, the emm sequences of 1-3 strains of each M-type had!95% sequence identity over the first 160nt with corresponding emm genes in Genbank. Six other M types had emm sequences that matched emm genes of different designations. Second part - typing clinical isolates 77 recent clinical GAS isolates emm sequences obtained from 74 Results in Table
7 Second part - typing clinical isolates emm sequences of 69 (out of 74) matched known emm-types Those that didn t match, belonged to new emm-types Third part - typing M types previously not sequenced Six 5 emm sequences for known M-serotypes were obtained All showed <95% nt identity to other emmtypes (Table 2) JOURNAL OF CLINICAL MICROBIOLOGY, Apr. 1996, p Vol. 34, No. 4 Sequencing emm-specific PCR Products for Routine and Accurate Typing of Group A Streptococci SUMMARY BERNARD BEALL, RICHARD FACKLAM, and TERRY THOMPSON 1. emm gene sequencing is an alternative to M-serotyping of GAS 2. Members of the same M-serotype almost always belonged to the same emm-sequence type 3. Six more emm genes were sequenced (increasing the emm sequence-type database) 4. Could now sequence-type the M-nontypeable strains. 5. Successfully used sequence typing to track an outbreak of GAS infections in a hospital (single-source). Concluding remarks emm sequence typing is the current gold standard for typing GAS isolates You need to know the definition of emm types, and the way emm types are determined. You should know the structure and significance of the M protein (and its gene). emm genes occur in group G and C streptococci, and these organisms can be typed using the same scheme as for GAS. 7
Sequencing emm-specific PCR Products for Routine and Accurate Typing of Group A Streptococci
JOURNAL OF CLINICAL MICROBIOLOGY, Apr. 1996, p. 953 958 Vol. 34, No. 4 0095-1137/96/$04.00 0 Copyright 1996, American Society for Microbiology Sequencing emm-specific PCR Products for Routine and Accurate
More informationAdd 5µl of 3N NaOH to DNA sample (final concentration 0.3N NaOH).
Bisulfite Treatment of DNA Dilute DNA sample to 2µg DNA in 50µl ddh 2 O. Add 5µl of 3N NaOH to DNA sample (final concentration 0.3N NaOH). Incubate in a 37ºC water bath for 30 minutes. To 55µl samples
More informationSupplemental material
Supplemental material Diversity of O-antigen repeat-unit structures can account for the substantial sequence variation of Wzx translocases Yaoqin Hong and Peter R. Reeves School of Molecular Bioscience,
More informationMaterials Protein synthesis kit. This kit consists of 24 amino acids, 24 transfer RNAs, four messenger RNAs and one ribosome (see below).
Protein Synthesis Instructions The purpose of today s lab is to: Understand how a cell manufactures proteins from amino acids, using information stored in the genetic code. Assemble models of four very
More informationLecture 10, 20/2/2002: The process of solution development - The CODEHOP strategy for automatic design of consensus-degenerate primers for PCR
Lecture 10, 20/2/2002: The process of solution development - The CODEHOP strategy for automatic design of consensus-degenerate primers for PCR 1 The problem We wish to clone a yet unknown gene from a known
More informationElectronic Supplementary Information
Electronic Supplementary Material (ESI) for Molecular BioSystems. This journal is The Royal Society of Chemistry 2017 Electronic Supplementary Information Dissecting binding of a β-barrel outer membrane
More informationORFs and genes. Please sit in row K or forward
ORFs and genes Please sit in row K or forward https://www.flickr.com/photos/teseum/3231682806/in/photostream/ Question: why do some strains of Vibrio cause cholera and others don t? Methods Mechanisms
More informationPGRP negatively regulates NOD-mediated cytokine production in rainbow trout liver cells
Supplementary Information for: PGRP negatively regulates NOD-mediated cytokine production in rainbow trout liver cells Ju Hye Jang 1, Hyun Kim 2, Mi Jung Jang 2, Ju Hyun Cho 1,2,* 1 Research Institute
More informationstrain devoid of the aox1 gene [1]. Thus, the identification of AOX1 in the intracellular
Additional file 2 Identification of AOX1 in P. pastoris GS115 with a Mut s phenotype Results and Discussion The HBsAg producing strain was originally identified as a Mut s (methanol utilization slow) strain
More informationProject 07/111 Final Report October 31, Project Title: Cloning and expression of porcine complement C3d for enhanced vaccines
Project 07/111 Final Report October 31, 2007. Project Title: Cloning and expression of porcine complement C3d for enhanced vaccines Project Leader: Dr Douglas C. Hodgins (519-824-4120 Ex 54758, fax 519-824-5930)
More informationFigure S1. Characterization of the irx9l-1 mutant. (A) Diagram of the Arabidopsis IRX9L gene drawn based on information from TAIR (the Arabidopsis
1 2 3 4 5 6 7 8 9 10 11 12 Figure S1. Characterization of the irx9l-1 mutant. (A) Diagram of the Arabidopsis IRX9L gene drawn based on information from TAIR (the Arabidopsis Information Research). Exons
More informationConverting rabbit hybridoma into recombinant antibodies with effective transient production in an optimized human expression system
Converting rabbit hybridoma into recombinant antibodies with effective transient production in an optimized human expression system Dr. Tim Welsink Molecular Biology Transient Gene Expression OUTLINE Short
More informationSupplementary. Table 1: Oligonucleotides and Plasmids. complementary to positions from 77 of the SRα '- GCT CTA GAG AAC TTG AAG TAC AGA CTG C
Supplementary Table 1: Oligonucleotides and Plasmids 913954 5'- GCT CTA GAG AAC TTG AAG TAC AGA CTG C 913955 5'- CCC AAG CTT ACA GTG TGG CCA TTC TGC TG 223396 5'- CGA CGC GTA CAG TGT GGC CAT TCT GCT G
More informationLegends for supplementary figures 1-3
High throughput resistance profiling of Plasmodium falciparum infections based on custom dual indexing and Illumina next generation sequencing-technology Sidsel Nag 1,2 *, Marlene D. Dalgaard 3, Poul-Erik
More informationSupplemental Data Supplemental Figure 1.
Supplemental Data Supplemental Figure 1. Silique arrangement in the wild-type, jhs, and complemented lines. Wild-type (WT) (A), the jhs1 mutant (B,C), and the jhs1 mutant complemented with JHS1 (Com) (D)
More informationSupplement 1: Sequences of Capture Probes. Capture probes were /5AmMC6/CTG TAG GTG CGG GTG GAC GTA GTC
Supplementary Appendixes Supplement 1: Sequences of Capture Probes. Capture probes were /5AmMC6/CTG TAG GTG CGG GTG GAC GTA GTC ACG TAG CTC CGG CTG GA-3 for vimentin, /5AmMC6/TCC CTC GCG CGT GGC TTC CGC
More informationSupporting information for Biochemistry, 1995, 34(34), , DOI: /bi00034a013
Supporting information for Biochemistry, 1995, 34(34), 10807 10815, DOI: 10.1021/bi00034a013 LESNIK 10807-1081 Terms & Conditions Electronic Supporting Information files are available without a subscription
More informationDisease and selection in the human genome 3
Disease and selection in the human genome 3 Ka/Ks revisited Please sit in row K or forward RBFD: human populations, adaptation and immunity Neandertal Museum, Mettman Germany Sequence genome Measure expression
More information7.03 Problem Set 3 Due before 5 PM on Wednesday, October 18 Hand in answers in recitation section or in the box outside of
7.03 Problem Set 3 Due before 5 PM on Wednesday, October 18 Hand in answers in recitation section or in the box outside of 68-120 1. The following DNA sequence fragment comes from the middle of a bacterial
More informationReceived 15 November 1996/Returned for modification 3 February 1997/Accepted 17 February 1997
JOURNAL OF CLINICAL MICROBIOLOGY, May 1997, p. 1231 1235 Vol. 35, No. 5 0095-1137/97/$04.00 0 Copyright 1997, American Society for Microbiology Survey of emm Gene Sequences and T-Antigen Types from Systemic
More informationMCB421 FALL2005 EXAM#3 ANSWERS Page 1 of 12. ANSWER: Both transposon types form small duplications of adjacent host DNA sequences.
Page 1 of 12 (10pts) 1. There are two mechanisms for transposition used by bacterial transposable elements: replicative (Tn3) and non-replicative (Tn5 and Tn10). Compare and contrast the two mechanisms
More informationHes6. PPARα. PPARγ HNF4 CD36
SUPPLEMENTARY INFORMATION Supplementary Table Positions and Sequences of ChIP primers -63 AGGTCACTGCCA -79 AGGTCTGCTGTG Hes6-0067 GGGCAaAGTTCA ACOT -395 GGGGCAgAGTTCA PPARα -309 GGCTCAaAGTTCAaGTTCA CPTa
More informationTitle:Streptococcus pyogenes strains in Sao Paulo, Brazil: molecular characterization as a basis for StreptInCor coverage capacity analysis.
Author's response to reviews Title:Streptococcus pyogenes strains in Sao Paulo, Brazil: molecular characterization as a basis for StreptInCor coverage capacity analysis. Authors: Samar Freschi de Barros
More informationSupporting Information. Trifluoroacetophenone-Linked Nucleotides and DNA for Studying of DNA-protein Interactions by 19 F NMR Spectroscopy
Supporting Information Trifluoroacetophenone-Linked Nucleotides and DNA for Studying of DNA-protein Interactions by 19 F NMR Spectroscopy Agata Olszewska, Radek Pohl and Michal Hocek # * Institute of Organic
More informationQuantitative reverse-transcription PCR. Transcript levels of flgs, flgr, flia and flha were
1 Supplemental methods 2 3 4 5 6 7 8 9 1 11 12 13 14 15 16 17 18 19 21 22 23 Quantitative reverse-transcription PCR. Transcript levels of flgs, flgr, flia and flha were monitored by quantitative reverse-transcription
More informationPCR analysis was performed to show the presence and the integrity of the var1csa and var-
Supplementary information: Methods: Table S1: Primer Name Nucleotide sequence (5-3 ) DBL3-F tcc ccg cgg agt gaa aca tca tgt gac tg DBL3-R gac tag ttt ctt tca ata aat cac tcg c DBL5-F cgc cct agg tgc ttc
More informationY-chromosomal haplogroup typing Using SBE reaction
Schematic of multiplex PCR followed by SBE reaction Multiplex PCR Exo SAP purification SBE reaction 5 A 3 ddatp ddgtp 3 T 5 A G 3 T 5 3 5 G C 5 3 3 C 5 ddttp ddctp 5 T 3 T C 3 A 5 3 A 5 5 C 3 3 G 5 3 G
More informationNESTED Sequence-based Typing (SBT) protocol for epidemiological typing of Legionella pneumophila directly from clinical samples
NESTED Sequence-based Typing (SBT) protocol for epidemiological typing of Legionella pneumophila directly from clinical samples VERSION 2.0 SUMMARY This procedure describes the use of nested Sequence-Based
More informationการสอบสวนโรคต ดเช อในโรงพยาบาล
การสอบสวนโรคต ดเช อในโรงพยาบาล MRSA Model in Rajavithi Hospital by Chanwit Tribuddharat, M.D., Ph.D. Department of Microbiology Faculty of Medicine Siriraj Hospital Mahidol University E-mail sictb@mahidol.ac.th
More informationDNA sentences. How are proteins coded for by DNA? Materials. Teacher instructions. Student instructions. Reflection
DNA sentences How are proteins coded for by DNA? Deoxyribonucleic acid (DNA) is the molecule of life. DNA is one of the most recognizable nucleic acids, a double-stranded helix. The process by which DNA
More informationSupporting Information
Supporting Information Barderas et al. 10.1073/pnas.0801221105 SI Text: Docking of gastrin to Constructed scfv Models Interactive predocking of the 4-WL-5 motif into the central pocket observed in the
More informationSAY IT WITH DNA: Protein Synthesis Activity by Larry Flammer
TEACHER S GUIDE SAY IT WITH DNA: Protein Synthesis Activity by Larry Flammer SYNOPSIS This activity uses the metaphor of decoding a secret message for the Protein Synthesis process. Students teach themselves
More informationSupplementary Appendix
Supplementary Appendix This appendix has been provided by the authors to give readers additional information about their work. Supplement to: Blanken MO, Rovers MM, Molenaar JM, et al. Respiratory syncytial
More informationMultiplexing Genome-scale Engineering
Multiplexing Genome-scale Engineering Harris Wang, Ph.D. Department of Systems Biology Department of Pathology & Cell Biology http://wanglab.c2b2.columbia.edu Rise of Genomics An Expanding Toolbox Esvelt
More informationArabidopsis actin depolymerizing factor AtADF4 mediates defense signal transduction triggered by the Pseudomonas syringae effector AvrPphB
Arabidopsis actin depolymerizing factor mediates defense signal transduction triggered by the Pseudomonas syringae effector AvrPphB Files in this Data Supplement: Supplemental Table S1 Supplemental Table
More informationCat. # Product Size DS130 DynaExpress TA PCR Cloning Kit (ptakn-2) 20 reactions Box 1 (-20 ) ptakn-2 Vector, linearized 20 µl (50 ng/µl) 1
Product Name: Kit Component TA PCR Cloning Kit (ptakn-2) Cat. # Product Size DS130 TA PCR Cloning Kit (ptakn-2) 20 reactions Box 1 (-20 ) ptakn-2 Vector, linearized 20 µl (50 ng/µl) 1 2 Ligation Buffer
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/10/494/eaan6284/dc1 Supplementary Materials for Activation of master virulence regulator PhoP in acidic ph requires the Salmonella-specific protein UgtL Jeongjoon
More informationEngineering D66N mutant using quick change site directed mutagenesis. Harkewal Singh 09/01/2010
Engineering D66N mutant using quick change site directed mutagenesis Harkewal Singh 09/01/2010 1 1- What is quick change site directed mutagenesis? 2- An overview of the kit contents. 3- A brief information
More informationGene synthesis by circular assembly amplification
Gene synthesis by circular assembly amplification Duhee Bang & George M Church Supplementary figures and text: Supplementary Figure 1. Dpo4 gene (1.05kb) construction by various methods. Supplementary
More informationNAME:... MODEL ANSWER... STUDENT NUMBER:... Maximum marks: 50. Internal Examiner: Hugh Murrell, Computer Science, UKZN
COMP710, Bioinformatics with Julia, Test One, Thursday the 20 th of April, 2017, 09h30-11h30 1 NAME:...... MODEL ANSWER... STUDENT NUMBER:...... Maximum marks: 50 Internal Examiner: Hugh Murrell, Computer
More informationLecture 19A. DNA computing
Lecture 19A. DNA computing What exactly is DNA (deoxyribonucleic acid)? DNA is the material that contains codes for the many physical characteristics of every living creature. Your cells use different
More informationSupplemental Data. mir156-regulated SPL Transcription. Factors Define an Endogenous Flowering. Pathway in Arabidopsis thaliana
Cell, Volume 138 Supplemental Data mir156-regulated SPL Transcription Factors Define an Endogenous Flowering Pathway in Arabidopsis thaliana Jia-Wei Wang, Benjamin Czech, and Detlef Weigel Table S1. Interaction
More informationSupporting Information
Supporting Information Table S1. Oligonucleotide sequences used in this work Oligo DNA A B C D CpG-A CpG-B CpG-C CpG-D Sequence 5 ACA TTC CTA AGT CTG AAA CAT TAC AGC TTG CTA CAC GAG AAG AGC CGC CAT AGT
More informationSupplemental Table 1. Mutant ADAMTS3 alleles detected in HEK293T clone 4C2. WT CCTGTCACTTTGGTTGATAGC MVLLSLWLIAAALVEVR
Supplemental Dataset Supplemental Table 1. Mutant ADAMTS3 alleles detected in HEK293T clone 4C2. DNA sequence Amino acid sequence WT CCTGTCACTTTGGTTGATAGC MVLLSLWLIAAALVEVR Allele 1 CCTGTC------------------GATAGC
More informationGENETICS and the DNA code NOTES
GENETICS and the DNA code NOTES BACKGROUND DNA is the hereditary material of most organisms. It is an organic compound made of two strands, twisted around one another to form a double helix. Each strand
More informationΔPDD1 x ΔPDD1. ΔPDD1 x wild type. 70 kd Pdd1. Pdd3
Supplemental Fig. S1 ΔPDD1 x wild type ΔPDD1 x ΔPDD1 70 kd Pdd1 50 kd 37 kd Pdd3 Supplemental Fig. S1. ΔPDD1 strains express no detectable Pdd1 protein. Western blot analysis of whole-protein extracts
More informationhcd1tg/hj1tg/ ApoE-/- hcd1tg/hj1tg/ ApoE+/+
ApoE+/+ ApoE-/- ApoE-/- H&E (1x) Supplementary Figure 1. No obvious pathology is observed in the colon of diseased ApoE-/me. Colon samples were fixed in 1% formalin and laid out in Swiss rolls for paraffin
More informationDNA is the MASTER PLAN. RNA is the BLUEPRINT of the Master Plan
Sec. 12-3 RNA and Protein Synthesis Roles of DNA and RNA DNA is the MASTER PLAN RNA is the BLUEPRINT of the Master Plan 1 RNA uses the information from DNA to make proteins Differs from DNA: 1. Ribose
More informationTRANSCRIPTION. Renáta Schipp
TRANSCRIPTION Renáta Schipp Gene expression Gene expression: - is the process by which information from a gene is used for the synthesis of gene products. These products are proteins, but in the case of
More informationEvent-specific Method for the Quantification of Soybean SYHT0H2 by Real-time PCR. Validated Method
EUROPEAN COMMISSION JOINT RESEARCH CENTRE Institute for Health and Consumer Protection Molecular Biology and Genomics Unit Event-specific Method for the Quantification of Soybean SYHT0H2 by Real-time PCR
More informationMULTIPLE CHOICE. Choose the one alternative that best completes the statement or answers the question.
Ch 17 Practice Questions MULTIPLE CHOICE. Choose the one alternative that best completes the statement or answers the question. 1) Garrod hypothesized that "inborn errors of metabolism" such as alkaptonuria
More informationSupplementary Figure 1. Localization of MST1 in RPE cells. Proliferating or ciliated HA- MST1 expressing RPE cells (see Fig. 5b for establishment of
Supplementary Figure 1. Localization of MST1 in RPE cells. Proliferating or ciliated HA- MST1 expressing RPE cells (see Fig. 5b for establishment of the cell line) were immunostained for HA, acetylated
More informationMULTIPLE CHOICE. Choose the one alternative that best completes the statement or answers the question.
Exam Chapter 17 Genes to Proteins Name MULTIPLE CHOICE. Choose the one alternative that best completes the statement or answers the question. The following questions refer to Figure 17.1, a simple metabolic
More informationSupporting Information. Copyright Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim, 2006
Supporting Information Copyright Wiley-VCH Verlag GmbH & Co. KGaA, 69451 Weinheim, 2006 Copyright Wiley-VCH Verlag GmbH & Co. KGaA, 69451 Weinheim, 2006 Supporting Information for Expanding the Genetic
More informationCHE-3H84: Protein Engineering Past Exam Papers
CHE-3H84: Protein Engineering Past Exam Papers Sorted by Topic then Year Knowledge-Based Engineering of Proteins, Large Scale Production of Recombinant Proteins, and Protein Purification Dr. Hemmings 2006/7
More informationPRINCIPLES OF BIOINFORMATICS
PRINCIPLES OF BIOINFORMATICS BIO540/STA569/CSI660, Fall 2010 Lecture 3 (Sep-13-2010) Primer on Molecular Biology/Genomics Igor Kuznetsov Department of Epidemiology & Biostatistics Cancer Research Center
More informationSupplementary Figure 1A A404 Cells +/- Retinoic Acid
Supplementary Figure 1A A44 Cells +/- Retinoic Acid 1 1 H3 Lys4 di-methylation SM-actin VEC cfos (-) RA (+) RA 14 1 1 8 6 4 H3 Lys79 di-methylation SM-actin VEC cfos (-) RA (+) RA Supplementary Figure
More informationSupplemental Table 1. Primers used for PCR.
Supplemental Table 1. Primers used for PCR. Gene Type Primer Sequence Genotyping and semi-quantitative RT-PCR F 5 -TTG CCC GAT CAC CAT CTG TA-3 rwa1-1 R 5 -TGT AGC GAT CAA GGC CTG ATC TAA-3 LB 5 -TAG CAT
More informationDNA, RNA, and PROTEIN SYNTHESIS
DNA, RNA, and PROTEIN SYNTHESIS 1 DNA DNA contains genes, sequences of nucleotide bases The genes code for polypeptides (proteins) Proteins are used to build cells and do much of the work inside cells
More informationevaluated with UAS CLB eliciting UAS CIT -N Libraries increase in the
Supplementary Figures Supplementary Figure 1: Promoter scaffold library assemblies. Many ensembless of libraries were evaluated in this work. As a legend, the box outline color in top half of the figure
More informationTable S1. Bacterial strains (Related to Results and Experimental Procedures)
Table S1. Bacterial strains (Related to Results and Experimental Procedures) Strain number Relevant genotype Source or reference 1045 AB1157 Graham Walker (Donnelly and Walker, 1989) 2458 3084 (MG1655)
More informationSUPPLEMENTARY MATERIALS AND METHODS. E. coli strains, plasmids, and growth conditions. Escherichia coli strain P90C (1)
SUPPLEMENTARY MATERIALS AND METHODS E. coli strains, plasmids, and growth conditions. Escherichia coli strain P90C (1) dinb::kan (lab stock) derivative was used as wild-type. MG1655 alka tag dinb (2) is
More informationAn engineered tryptophan zipper-type peptide as a molecular recognition scaffold
SUPPLEMENTARY MATERIAL An engineered tryptophan zipper-type peptide as a molecular recognition scaffold Zihao Cheng and Robert E. Campbell* Supplementary Methods Library construction for FRET-based screening
More informationTechnical University of Denmark. Written examination, 29 May 2012 Course name: Life Science. Course number: Aids allowed: Written material
1 Technical University of Denmark Written examination, 29 May 2012 Course name: Life Science Course number: 27008 Aids allowed: Written material Exam duration: 4 hours Weighting: The exam set consists
More informationRPA-AB RPA-C Supplemental Figure S1: SDS-PAGE stained with Coomassie Blue after protein purification.
RPA-AB RPA-C (a) (b) (c) (d) (e) (f) Supplemental Figure S: SDS-PAGE stained with Coomassie Blue after protein purification. (a) RPA; (b) RPA-AB; (c) RPA-CDE; (d) RPA-CDE core; (e) RPA-DE; and (f) RPA-C
More informationSupporting Online Information
Supporting Online Information Isolation of Human Genomic DNA Sequences with Expanded Nucleobase Selectivity Preeti Rathi, Sara Maurer, Grzegorz Kubik and Daniel Summerer* Department of Chemistry and Chemical
More informationSupplemental Information. Human Senataxin Resolves RNA/DNA Hybrids. Formed at Transcriptional Pause Sites. to Promote Xrn2-Dependent Termination
Supplemental Information Molecular Cell, Volume 42 Human Senataxin Resolves RNA/DNA Hybrids Formed at Transcriptional Pause Sites to Promote Xrn2-Dependent Termination Konstantina Skourti-Stathaki, Nicholas
More informationSupporting Information
Supporting Information Transfection of DNA Cages into Mammalian Cells Email: a.turberfield@physics.ox.ac.uk Table of Contents Supporting Figure 1 DNA tetrahedra used in transfection experiments 2 Supporting
More informationG+C content. 1 Introduction. 2 Chromosomes Topology & Counts. 3 Genome size. 4 Replichores and gene orientation. 5 Chirochores.
1 Introduction 2 Chromosomes Topology & Counts 3 Genome size 4 Replichores and gene orientation 5 Chirochores 6 7 Codon usage 121 marc.bailly-bechet@univ-lyon1.fr Bacterial genome structures Introduction
More informationRecitation CHAPTER 9 DNA Technologies
Recitation CHAPTER 9 DNA Technologies DNA Cloning: General Scheme A cloning vector and eukaryotic chromosomes are separately cleaved with the same restriction endonuclease. (A single chromosome is shown
More informationThr Gly Tyr. Gly Lys Asn
Your unique body characteristics (traits), such as hair color or blood type, are determined by the proteins your body produces. Proteins are the building blocks of life - in fact, about 45% of the human
More informationLecture 11: Gene Prediction
Lecture 11: Gene Prediction Study Chapter 6.11-6.14 1 Gene: A sequence of nucleotides coding for protein Gene Prediction Problem: Determine the beginning and end positions of genes in a genome Where are
More informationComputing for Biologists, Part I Python vs. Pathogens
Computing for Biologists, Part I Python vs. Pathogens Acknowledgement: The following slides are adopted, some with minor revisions, from several lecture slides of the CS5 Green course at Harvey Mudd. Computer
More informationPrimer Design Workshop. École d'été en géné-que des champignons 2012 Dr. Will Hintz University of Victoria
Primer Design Workshop École d'été en géné-que des champignons 2012 Dr. Will Hintz University of Victoria Scenario You have discovered the presence of a novel endophy5c organism living inside the cells
More informationCourse Introduction. Bioinformatics: Issues and Algorithms. CSE Fall 2007 Lecture 1
Course Introduction Bioinformatics: Issues and Algorithms CSE 308-408 Fall 2007 Lecture 1-1- Motivation "Biology easily has 500 years of exciting problems to work on." Donald E. Knuth Good news: no prior
More informationTable S2. Oligonucleotide primers used to amplify pile and tcpa genes. Restriction endonuclease sites are underlined. Oligonucleotide Gene/ Sequence
The metal binding site Even though metals were not added to the crystallization mixture, a strong positive peak (56 sigma) in the fo fc electron density map clearly shows the tetrahedral coordination of
More information5. Which of the following enzymes catalyze the attachment of an amino acid to trna in the formation of aminoacyl trna?
Sample Examination Questions for Exam 3 Material Biology 3300 / Dr. Jerald Hendrix Warning! These questions are posted solely to provide examples of past test questions. There is no guarantee that any
More informationMIT Department of Biology 7.013: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr.
MIT Department of Biology 7.01: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr. Claudette Gardel iv) Would Xba I be useful for cloning? Why or why not?
More informationSupporting Information
Supporting Information Park et al. 10.1073/pnas.1410555111 5 -TCAAGTCCATCTACATGGCC-3 5 -CAGCTGCCCGGCTACTACTA-3 5 -TGCAGCTGCCCGGCTACTAC-3 5 -AAGCTGGACATCACCTCCCA-3 5 -TGACAGGAACACCTACAAGT-3 5 -AAGGCACCTTTCTGTCTCCA-3
More informationMolecular Profiles of Group B Streptococcal Surface Protein Antigen Genes: Relationship to Molecular Serotypes
JOURNAL OF CLINICAL MICROBIOLOGY, Feb. 2002, p. 620 626 Vol. 40, No. 2 0095-1137/02/$04.00 0 DOI: 10.1128/JCM.40.2.620 626.2002 Copyright 2002, American Society for Microbiology. All Rights Reserved. Molecular
More informationCSE : Computational Issues in Molecular Biology. Lecture 1. Spring 2004
CSE 397-497: Computational Issues in Molecular Biology Lecture 1 Spring 2004-1- Motivation http://www.ncbi.nlm.nih.gov/genbank/genbankstats.html "Biology easily has 500 years of exciting problems to work
More informationTransfection of CRISPR/Cas9 Nuclease NLS ribonucleoprotein (RNP) into adherent mammalian cells using Lipofectamine RNAiMAX
Transfection of CRISPR/Cas9 Nuclease NLS ribonucleoprotein (RNP) into adherent mammalian cells using Lipofectamine RNAiMAX INTRODUCTION The CRISPR/Cas genome editing system consists of a single guide RNA
More information1-Microbial Taxonomy: classification nomenclature identification
Part 1 Basic Medical Microbiology 1-Microbial Taxonomy: Taxonomy is the area of biologic science comprising three distinct, but highly interrelated, disciplines that include classification, nomenclature,
More information7.014 Problem Set 4 Answers to this problem set are to be turned in. Problem sets will not be accepted late. Solutions will be posted on the web.
MIT Department of Biology 7.014 Introductory Biology, Spring 2005 Name: Section : 7.014 Problem Set 4 Answers to this problem set are to be turned in. Problem sets will not be accepted late. Solutions
More informationwww.lessonplansinc.com Topic: Gene Mutations WS Summary: Students will learn about frame shift mutations and base substitution mutations. Goals & Objectives: Students will be able to demonstrate how mutations
More informationGenes and Proteins. Objectives
Genes and Proteins Lecture 15 Objectives At the end of this series of lectures, you should be able to: Define terms. Explain the central dogma of molecular biology. Describe the locations, reactants, and
More informationOverexpression Normal expression Overexpression Normal expression. 26 (21.1%) N (%) P-value a N (%)
SUPPLEMENTARY TABLES Table S1. Alteration of ZNF322A protein expression levels in relation to clinicopathological parameters in 123 Asian and 74 Caucasian lung cancer patients. Asian patients Caucasian
More informationDETERMINATION OF THE Rh FACTOR BY PCR
DETERMINATION OF THE Rh FACTOR BY PCR Ref.: PCR2 1. EXPERIMENT OBJECTIVE The aim of this experiment is to introduce students to the principles and practice of the Polymerase Chain Reaction (PCR) by studying
More informationFour different segments of a DNA molecule are represented below.
Four different segments of a DNA molecule are represented below. There is an error in the DNA in which molecule? A. segment 1 only B. segment 3 only C. segment 2 and 3 D. segment 2 and 4 Explain the basic
More informationSupplemental Information. Target-Mediated Protection of Endogenous. MicroRNAs in C. elegans. Inventory of Supplementary Information
Developmental Cell, Volume 20 Supplemental Information Target-Mediated Protection of Endogenous MicroRNAs in C. elegans Saibal Chatterjee, Monika Fasler, Ingo Büssing, and Helge Großhans Inventory of Supplementary
More informationCh 10.4 Protein Synthesis
Ch 10.4 Protein Synthesis I) Flow of Genetic Information A) DNA is made into RNA which undergoes transcription and translation to be made into a protein. II) RNA Structure and Function A) RNA contains
More informationInterpretation of sequence results
Interpretation of sequence results An overview on DNA sequencing: DNA sequencing involves the determination of the sequence of nucleotides in a sample of DNA. It use a modified PCR reaction where both
More informationCodon Bias with PRISM. 2IM24/25, Fall 2007
Codon Bias with PRISM 2IM24/25, Fall 2007 from RNA to protein mrna vs. trna aminoacid trna anticodon mrna codon codon-anticodon matching Watson-Crick base pairing A U and C G binding first two nucleotide
More informationAbstract... i. Committee Membership... iii. Foreword... vii. 1 Scope Introduction Standard Precautions References...
Vol. 28 No. 12 Replaces MM18-P Vol. 27 No. 22 Interpretive Criteria for Identification of Bacteria and Fungi by DNA Target Sequencing; Approved Guideline Sequencing DNA targets of cultured isolates provides
More informationSUPPORTING INFORMATION FILE
Intrinsic and extrinsic connections of Tet3 dioxygenase with CXXC zinc finger modules Nan Liu, Mengxi Wang, Wen Deng, Christine S. Schmidt, Weihua Qin, Heinrich Leonhardt and Fabio Spada Department of
More informationChapter 8. Microbial Genetics. Lectures prepared by Christine L. Case. Copyright 2010 Pearson Education, Inc.
Chapter 8 Microbial Genetics Lectures prepared by Christine L. Case Structure and Function of Genetic Material Learning Objectives 8-1 Define genetics, genome, chromosome, gene, genetic code, genotype,
More information2
1 2 3 4 5 6 7 Supplemental Table 1. Magnaporthe oryzae strains generated in this study. Strain background Genotype Strain name Description Guy-11 H1:RFP H1:RFP Strain expressing Histone H1- encoding gene
More informationTranslation BIT 220 Chapter 13
Translation BIT 220 Chapter 13 Making protein from mrna Most genes encode for proteins -some make RNA as end product Proteins -Monomer Amino Acid 20 amino acids -peptides -polypeptides -Structure of Amino
More informationMacBlunt PCR Cloning Kit Manual
MacBlunt PCR Cloning Kit Manual Shipping and Storage MacBlunt PCR Cloning Kits are shipped on dry ice. Each kit contains a box with cloning reagents and an attached bag with Eco-Blue Competent Cells (optional).
More informationPROTEIN SYNTHESIS. copyright cmassengale
PROTEIN SYNTHESIS 1 DNA and Genes 2 Roles of RNA and DNA DNA is the MASTER PLAN RNA is the BLUEPRINT of the Master Plan 3 RNA Differs from DNA RNA has a sugar ribose DNA has a sugar deoxyribose 4 Other
More information