Gene editing in cereals
|
|
- Eustacia Bishop
- 6 years ago
- Views:
Transcription
1 University of Minnesota Gene editing in cereals Mick Ayliffe
2 The importance of cereals in Australian agriculture VALUE OF AGRICULTURAL COMMODITIES PRODUCED IN Australia (year ended 30 June 2016)
3 Gene editing in cereals wheat Platforms Oligonucleotide directed targeting Mega nucleases Zn 2+ finger nucleases TALENs CRISPR/Cas9 9bp FokI nuclease FokI nuclease 9bp barley, rice
4 TALEN editing in wheat Wheat Origin Transf. eff Stable wheat transgenics produced using high efficiency Fielder USA 41% Japan Tobacco Agrobacterium system Gladius Aust 32% Westonia Aust 45% Mace Aust 25% Stewart - durum Can 26% Kronos - durum USA 51% Mutus Mexico 24% Kachu Mexico 40% Navajoa Mexico 27%
5 TALEN editing in wheat TALEN targeting of a pre-existing transgene in wheat LB Ubi TALEN GUS1 nos NPTII RB LB Ubi TALEN GUS2 nos NPTII RB co-transformation LB Ubi uida nos BAR RB Fielder wheat line containing single GUS transgene T0 lines selected with all three transgenes
6 TALEN editing in wheat TALEN deletions observed in the GUS gene uida PCR RE assay 18c 17b 21b 2a 32a ve BclI TALEN GUS1 TALEN GUS2 GUS targetgtgggcattcagtctggatcgcgaaaactgtggaattgatcagcgttggtgggaaagcgcgttacaagaaagccgggcaatt Plant 45 GTGGGCATTCAGTCTGGATCGCGAAAACTGTGGAATT----AGCGTTGGTGGGAAAGCGCGTTACAAGAAAGCCGGGCAATT Plant 21B GTGGGCATTCAGTCTGGATCGCGAAAACTGTGGAATT---CAGCGTTGGTGGGAAAGCGCGTTACAAGAAAGCCGGGCAATT Plant 38 GTGGGCATTCAGTCTGGATCGCGAAAA CAGCGTTGGTGGGAAAGCGCGTTACAAGAAAGCCGGGCAATT digestion resistant products cloned and sequenced 25% of T0 wheat showed cleavage of GUS (3/12 transgenics)
7 TALEN editing in wheat Gene editing in the absence of a repair template ie. (NHEJ) usually causes gene knockout (excluding promoter sequences) But these events, unlike repair template events, are the most likely to be considered as nongm (if any)????! Can NHEJ be used to recreate a gene function?? Can we bring a pseudogene back from the dead!!!
8 TALEN editing in wheat wt Lr21 rust resistance gene provides resistance to wheat leaf rust Lr21 Fielder lr21 psuedogene lr21 1 bp deln in ORF = out of frame Can we restore ORF frame and function by NHEJ? - Deletion occurs in nonconserved region of the protein - 5 regulatory region shown to be functional (Huang et al, 2009) - protein differs by just two a.a. compared with wt
9 TALEN editing in wheat Fielder co-transformed with a Lr21 TALEN pair LB Ubi TALEN Lr21a nos NPTII RB LB Ubi TALEN Lr21b nos NPTII RB Fielder Lr21 psuedogene TALEN Lr21a TALEN Lr21b cacgtttgcaggatatattcaagattacataa-ggaggaatgcaaggatgagaaacttttcgaca Homozygous 3 bp deletion Numbers = no. T0 plants with alteration at this site T0 Fielder wheat plants CAAGATTACATAA-GGAGGAATGCAAGGATGAGAAACTTTTCGACA 28 plants (80%) had target site alteration T0 plant is homozygous for a 4bp deletion
10 TALEN editing in wheat Heritability of gene modification Mendelian in some cases with no evidence of T0 chimerism Plant 14 Head 1 Head 2 Head 3 Head 4 Total wt het mt new? X 2 3:1 p = 0.62 Plant 27 No inheritance of a mutant allele amongst 38 T1 screened
11 TALEN editing in wheat T1 progeny homozygous for modified alleles Lr21 P14 P20 P20 P16 P24 P24 tttgcaggatatattcaagattacataaaggaggaatgcaaggatgagaaactt Tttgcaggatatattcaagattac------aaggaatgcaaggatgagaaactt tttgcaggatatattcaagattac------aaggaatgcaaggatgagaaactt tttgcaggatatattcaaga ggaatgcaaggatgagaaactt tttgcaggatatattcaagatta atgcaaggatgagaaactt tttgcaggatatattcaagattac aggaatgcaaggatgagaaactt tttgcaggatatattcaagattaca-----gaggaatgcaaggatgagaaactt in frame stop codon out of frame Proteins encoded by restored alleles homozygous in T1 progeny Lr21 P14 P20 P20 YSVIGIYGVAGSGKTTFAGYIQDYIKEECKDEKLFDTIMCIHVTETFSVDDIF YSVIGIYGVAGSGKTTFAGYIQDY-K-ECKDEKLFDTIMCIHVTETFSVDDIF YSVIGIYGVAGSGKTTFAGYIQDY-K-ECKDEKLFDTIMCIHVTETFSVDDIF YSVIGIYGVAGSGKTTFAGYIQ----EECKDEKLFDTIMCIHVTETFSVDDIF
12 TALEN editing in wheat Do any of these restored full length proteins provide rust resistance? Challenged T1 seedlings with wheat leaf rust Lr21 lr21
13 TALEN editing in wheat Do any of these restored full length proteins provide rust resistance? NO! Moral of the story - TALENs work with high efficiency in wheat - it is easier to destroy gene function than create even with gene editing!!
14 CRISPR/Cas9 editing in barley Brett Ford Simultaneous gene editing of a barley gene family Barley Flower Promoting Factor 1-like gene family targeted with CRISPR FPF1-like FPF1-like Two genes on 1 chromosome FPF1-like Third gene on another chromosome Single grna target U6 grna Ubi pcas9 Tnos
15 CRISPR/Cas9 editing in barley Brett Ford 12 transgenics made in barley cultivar Golden Promise 6 T0 showed evidence of CRISPR activity (50%) 2 (18%) had all 3 genes cleaved although monoallelic FPF1-likeA Ref Morex seq Golden Promise BF10-2 BF10-3 The 2 lines below have mutations in all 3 targeted FPF1-like genes wt mutant FPF1-likeB FPF1-likeD Ref Morex seq Golden Promise BF10-2 BF10-3 Ref Morex seq Golden Promise BF10-2 BF10-3 wt mutant wt mutant
16 CRISPR/Cas mediated gene editing in rice Ming Luo Multiplex gene editing of a tightly linked rice gene pair 10kb OsFIE1 OsFIE2 T1 T2 T3 T2 Targeted two tightly linked endosperm developmental genes OsFIE represses endosperm development U6 T1 grna U6 T2 grna U6 T3 grna Three target sites Ubi pcas9 Tnos Three different grnas
17 CRISPR/Cas mediated gene editing in rice Ming Luo OsFIE1: Mutations of OsFIE1andOsFIE2 at T1 WT(T1): TGGTGGAGTAGGAGGTCACCGACACGAAGTACTTGGTGTTGTAAGTTGCTTAAGCT Homo1: TGGTGGAGTAAGAGGTC...GGTGTTGTAAGTTGCTTAAGCT -17 Heter1: TGGTGGAGTAGGAGGTCACCGACACGAAGTAACTTGGTGTTGTAAGTTGCTTAAGCT +1 Bi-allelic: TGGTGGAGTAGGAGGTCACCGACACGA...ACTTGGTGTTGTAAGTTGCTTAAGCT -3 TGGTGGAGTAGGAGGTCACCGACACGAAGTTACTTGGTGTTGTAAGTTGCTTAAGCT +1 WT(T2): TCAACCATCGAATCCTTCACTCATCATTTCTGCAAGCAAGGTTAGAAGATTACAT Hete2: TCAACCATCGAATCCTTCACTCATCATTTCTGTAAGCAAGGTTAGAAGATTACAT +1 OsFIE2: WT(T2): ATAAGAACTCAAGCATTAAAGCCTTCGCTCATCATTTCTGCAAGCAAGGTTTGAAGA Heter1: ATAAGAACTCAAGCATTAAAGCCTTCGCTCATCATTTCTGC..GCAAGGTTTGAAGA -2 Heter2: ATAAGAACTCAAGCATTAAAGCCTTCGCTCATCATTTCT...GCAAGGTTTGAAGA -4 Heter3: ATAAGAACTCAAGCATTAAAGCCTTCGCTCATCATTTC...GCAAGGTTTGAAGA -5 Heter4: ATAAGAACTCAAGCATTAAAGCCTTCGCTCATCATTTCTG...GCAAGGTTTGAAGA -3 50% T0 rice had at least one allele edited Homozygous and biallelic KOs identified in T0 generation 4/100 T0 plants had both linked genes mutated Heter & Bi-allelic ATAAGAACTCAAGCATTAAAGCCTTCGCTCATCATTTCTGCAAGCAAGGTTTGAAGA ATAAGAACTCAAGCATTAAAGCCTTCGCTCATCATTTCT...GCAAGGTTTGAAGA -4 ATAAGAACTCAAGCATTAAAGCCTTCGCTCATCATTTCTGC..GCAAGGTTTGAAGA -2
18 CRISPR/Cas mediated gene editing in rice Ming Luo 10kb OsFIE1 OsFIE2 WT A B C E F Mutant phenotypes observed in these four T0 plants ie. endosperm formation in the absence of fertilisation G J Mendelian pollen transmission of double KO haplotype in these 4 plants W T Very difficult to achieve co-mutation of such tightly linked genes by conventional mutagenesis fie1 fie2 ~50% unfertilised ovules had autonomous endosperm development + +
19 Gene editing in cereals TALENs and CRISPR/Cas are good tool for gene KOs in wheat, barley and rice Gene replacement and gene targeting is where we want to be in future
20 Gene editing in cereals Potential future application Gene stacking of rust disease resistance genes in wheat R gene1 R1 R2 R3 R4 R5 Single pathogen mutation 5 independent mutations needed Overcome short lived Durable resistance Inherited as single locus
21 Gene editing in cereals 44 kb Lb Rb Hy Sr46 Sr45 Lr67 Sr50 Sr35 Sr22 R S R gene stacks with up to 6 genes Transgenic wheat with all genes full length Genes inherited as a single locus Resistance segregates as a single locus
22 Gene editing in cereals Can we add and subtract to the stack using gene editing? SrX Sr46 Sr45 Lr67 Sr50 Sr35 Sr22 Real utility!
23 Gene editing in cereals Summary - Highly efficient TALEN editing in wheat of a transgene and an endogenous gene - Simultaneous editing of a dispersed barley gene family in T0 plants - Multiplex gene editing of a tightly linked rice gene pair
24 Acknowledgements CSIRO Ag & Food Ming Luo Brett Ford Amy Rinaldo Xiaoba Wu Soma Chakraborty Melanie Soliveres Terese Richardson Dhara Bhatt Smitha Louis University of Tuebingen Thomas LaHaye Robert Morbitzer John Innes Institute Brande Wulff Burkhard Steuernagel South China Agriculture University Yaoguang Liu
Barley as a model for cereal engineering and genome editing. Wendy Harwood
Barley as a model for cereal engineering and genome editing Wendy Harwood MonoGram 29 th April 2015 www.bract.org BRACT Transformation Platform Over-expression of single genes RNAi based silencing Promoter
More informationRust Resistance Gene Cloning
University of Minnesota Rust Resistance Gene Cloning perfect markers and cassette development Peter Dodds BGRI technical workshop March 2014 Outlook: R gene pyramids via GM gene cassettes Stacking of multiple
More informationGene Editing in Cereals. Emma Wallington
Gene Editing in Cereals Emma Wallington emma.wallington@niab.com NIAB Group NIAB established in 1919 by charitable donations for the improvement of crops.. with higher.. genetic quality A charitable company
More informationPLNT2530 (2018) Unit 9. Genome Editing
PLNT2530 (2018) Unit 9 Genome Editing Unless otherwise cited or referenced, all content of this presenataion is licensed under the Creative Commons License Attribution Share-Alike 2.5 Canada 1 Genome Editing
More informationCRISPR/Cas9 Efficiency and Biological Impacts in Transgenic Poplars and Eucalypts. Estefania Elorriaga and Steven H. Strauss Oregon State University
CRISPR/Cas9 Efficiency and Biological Impacts in Transgenic Poplars and Eucalypts Estefania Elorriaga and Steven H. Strauss Oregon State University Background Outline CRISPR, goals, target genes Mutagenesis
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION High-efficiency TALEN-based gene editing produces disease-resistance rice Ting Li 1, Bo Liu 1, Martin H. Spalding 1, Donald P. Weeks 2, Bing Yang 1 * 1 Department of Genetics,
More informationSUPPLEMENTARY INFORMATION
Gene replacements and insertions in rice by intron targeting using CRISPR Cas9 Table of Contents Supplementary Figure 1. sgrna-induced targeted mutations in the OsEPSPS gene in rice protoplasts. Supplementary
More informationSUPPLEMENT MATERIALS FOR CURTIN,
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 SUPPLEMENT MATERIALS FOR CURTIN, et al. Validating genome-wide association candidates: Selecting, testing, and characterizing
More informationPlant Genome Modification Technologies and Applications Amitabh Mohanty DuPont Pioneer
Plant Genome Modification Technologies and Applications Amitabh Mohanty DuPont Pioneer International Conference on New Plant Breeding Molecular Technologies Technology Development And Regulation, Oct 9-,
More informationInnovative Trait Development Tools in Plant Breeding will be Crucial for Doubling Global Agricultural Productivity by 2050
Innovative Trait Development Tools in Plant Breeding will be Crucial for Doubling Global Agricultural Productivity by 2050 Greg Gocal, Ph.D., Senior Vice President, Research and Development CRISPR Precision
More information4 products on /near market
STEVE JOBLING, CSIRO AGRICULTURE, CANBERRA st 2017 4 products on /near market BARLEYmax > 12 years path to market and impact The Healthy Grain CSIRO F&N CSIRO Agriculture CSIRO F&N INDUSTRY Health concept
More informationCRISPR-Cas9 Genome Editing. New Era of Agricultural Biotechnology
2017 Grains Research Update - CRISPR-Cas9 Genome Editing New Era of Agricultural Biotechnology Yong Han & Chengdao Li y.han@murdoch.edu.au Western Barley Genetics Alliance 28 Feb,2017 One of the ten breakthrough
More informationUse of Gene Editing Technologies in Rodents. Carlisle P. Landel, Ph.D.
Use of Gene Editing Technologies in Rodents Carlisle P. Landel, Ph.D. The Mouse as A Model Mammal Small, easy to maintain, fecund Well understood genetics Similarity to humans >90% Availability of inbred
More informationMethods for Reverse genetics References:
Methods for Reverse genetics References: 1. Alonso JM, Ecker JR. Moving forward in reverse: genetic technologies to enable genomewide phenomic screens in Arabidopsis. Nat Rev Genet. 2006 Jul;7(7):524-36.
More informationA CRISPR/Cas9 Vector System for Tissue-Specific Gene Disruption in Zebrafish
Developmental Cell Supplemental Information A CRISPR/Cas9 Vector System for Tissue-Specific Gene Disruption in Zebrafish Julien Ablain, Ellen M. Durand, Song Yang, Yi Zhou, and Leonard I. Zon % larvae
More informationStrength in Numbers: Resistance Gene Cassettes for Durable Disease Control in Cereals
Strength in Numbers: Resistance Gene Cassettes for Durable Disease Control in Cereals Brian J. Steffenson Department of Plant Pathology University of Minnesota St. Paul 42 nd Barley Improvement Conference
More informationCRISPR AgBio Workshop London Vladimir Nekrasov
CRISPR AgBio Workshop London 2017 Vladimir Nekrasov Applying CRISPR-Cas9 technology in model and crop plants Model plant: Crop plants: Nicotiana benthamiana Tomato Barley Arabidopsis thaliana Maize Brassica
More informationNew Plant Breeding Techniques Group 1 Targeted Mutagenesis
WORKSHOP COMPERATIVE SITUATION OF NEW PLANT BREEDING TECHNIQUES 12-13 SEPTEMBER 2011 SEVILLE, SPAIN New Plant Breeding Techniques Group 1 Targeted Mutagenesis Maria Lusser Joint Research Centre, European
More informationGenome editing. Knock-ins
Genome editing Knock-ins Experiment design? Should we even do it? In mouse or rat, the HR-mediated knock-in of homologous fragments derived from a donor vector functions well. However, HR-dependent knock-in
More informationCRISPR/Cas9 Gene Editing Tools
CRISPR/Cas9 Gene Editing Tools - Guide-it Products for Successful CRISPR/Cas9 Gene Editing - Why choose Guide-it products? Optimized methods designed for speed and ease of use Complete kits that don t
More informationCRISPR/Cas9 Gene Editing Tools
CRISPR/Cas9 Gene Editing Tools - Separations Simply Spectacular INDELS Identify indels Determine if one or both copies of your gene have indels The Guide-it Genotype Confirmation Kit: Simple detection
More informationPlant Breeding. Opportunities of New Plant Breeding Techniques. Breeding projects at WUR-Plant Breeding
Opportunities of New Plant Breeding Techniques Jan Schaart Plant Breeding Important for crop improvement Combining of genetic variation Based on the steps of crossing and selection Limitations polyploidy,
More informationIncorporating SeqStudio Genetic Analyzer and Sanger sequencing into genome editing workflows
Incorporating SeqStudio Genetic Analyzer and Sanger sequencing into genome editing workflows Stephen Jackson, Ph.D 27 May 2017 The world leader in serving science Key Applications for Genome Editing Research
More informationCRISPR/Cas9 Genome Editing: Transfection Methods
CRISPR/ Genome Editing: Transfection Methods For over 20 years Mirus Bio has developed and manufactured high performance transfection products and technologies. That expertise is now being applied to the
More informationGenome editing as a new powerful tool for wheat breeding
Genome editing as a new powerful tool for wheat breeding Vladimir Nekrasov 15 th WGIN Stakeholders Meeting Applying CRISPR Cas9 technology in model and crop plants Model plant: Crop plants: Nicotiana
More informationGenome Engineering with ZFNs, TALENs and CRISPR/Cas9
Genome Engineering with ZFNs, TALENs and CRISPR/Cas9 Designer Endonucleases ZFNs (zinc finger nucleases), TALENs (transcription activator-like effector nucleases) and CRISPR/Cas9 (clustered regularly interspaced
More informationS1: MATERIALS AND METHODS TALEN
Supplemental File S1: MATERIALS AND METHODS TALEN design and synthesis TALEN target sites within the tomato PRO gene (Solyc11g011260.1) were identified using TAL Effector Nucleotide Targeter (TALE-NT)
More informationLecture 15: Functional Genomics II
Lecture 15: Functional Genomics II High-throughput RNAi screens High-throughput insertional/chemical screens Homologous recombination (yeast and mouse) - Other methods in discerning gene function Activation
More informationNEXT-GENERATION METHODS AND TOOLS FOR PLANT GENOME EDITING. Tomáš Čermák VIB CRISPR-CAS User meeting September 18th 2018
NEXT-GENERATION METHODS AND TOOLS FOR PLANT GENOME EDITING Tomáš Čermák VIB CRISPR-CAS User meeting September 18th 2018 Outline 1. How can we edit plant genomes? 2. What are the tools we can use? 3. How
More informationNew Plant Breeding Technologies
New Plant Breeding Technologies Ricarda A. Steinbrecher, PhD EcoNexus / ENSSER Berlin, 07 May 2015 r.steinbrecher@econexus.info distributed by EuropaBio What are the NPBTs? *RNAi *Epigenetic alterations
More informationIntroduction to CRISPR/Cas9 Background DNA Cleavage and Repair (NHEJ and HDR) Alternative Cas9 Variants Delivery of Cas9 and sgrna Library Products
Introduction to CRISPR/Cas9 Background DNA Cleavage and Repair (NHEJ and HDR) Alternative Cas9 Variants Delivery of Cas9 and sgrna Library Products which one is right for you? CRISPR Workflow abm s Toolbox
More informationIsolation of single-base genome-edited human ips cells without
Nature Methods Isolation of single-base genome-edited human ips cells without antibiotic selection Yuichiro Miyaoka, Amanda H. Chan, Luke M. Judge, Jennie Yoo, Miller Huang, Trieu D. Nguyen, Paweena P.
More informationCRISPR RNA-guided activation of endogenous human genes
CRISPR RNA-guided activation of endogenous human genes Morgan L Maeder, Samantha J Linder, Vincent M Cascio, Yanfang Fu, Quan H Ho, J Keith Joung Supplementary Figure 1 Comparison of VEGF activation induced
More informationksierzputowska.com Research Title: Using novel TALEN technology to engineer precise mutations in the genome of D. melanogaster
Research Title: Using novel TALEN technology to engineer precise mutations in the genome of D. melanogaster Research plan: Specific aims: 1. To successfully engineer transgenic Drosophila expressing TALENs
More informationCRISPR-mediated Genome Editing in Rice and Maize
CRISPR-mediated Genome Editing in Rice and Maize Bing Yang Department of Genetics, Development and Cell Biology Iowa State University byang@iastate.edu Nov. 30, 2017 A. Zinc finger nuclease B. TAL effector
More informationEnabling GMOs in forestry CRISPRs as tools to promote coexistence
Enabling GMOs in forestry CRISPRs as tools to promote coexistence Steve Strauss, Professor College of Forestry, Oregon State University Steve.Strauss@OregonState.Edu Estefania Elorriaga, PhD student Clark
More informationNew Plant Breeding Techniques: Zn Finger Nucleases and Transcription Factors
New Plant Breeding Techniques: Zn Finger Nucleases and Transcription Factors Andrew F. Roberts, Ph.D. Deputy Director, CERA September 19, 2013 Contents of the talk Old Plant Breeding Techniques and Biosafety
More informationAdding CRISPR to Your Bio-ARROW Protocol
Adding CRISPR to Your Bio-ARROW Protocol Table of Contents Work Covered by this Guidance Document... 2 Background... 2 VI. Materials and Activities... 3 VI. Materials and Activities - Recombinant Materials...
More informationSupplementary Information
Supplementary Information This Supplementary Information file contains the following contents: Supplementary Methods, Supplementary Discussion, Supplementary Figures (S1~S9), Supplementary Tables (1~3)
More informationGenome-scale engineering for systems and synthetic biology 彭文磊
Genome-scale engineering for systems and synthetic biology 彭文磊 Part 1 Part 2 Part 3 Introduction. Review current technologies and methodologies for genome-scale engineering. Discuss the prospects for extending
More informationBart Williams, PhD Van Andel Research Center
A History of Genome Editing in the Laboratory Implications for Translational Applications Bart Williams, PhD Van Andel Research Center Introduction by Matthew Denenberg, MD DeVos Childrens Hospital Disclosures:
More informationNature Genetics: doi: /ng Supplementary Figure 1
Supplementary Figure 1 Ihh interacts preferentially with its upstream neighboring gene Nhej1. Genes are indicated by gray lines, and Ihh and Nhej1 are highlighted in blue. 4C seq performed in E14.5 limbs
More informationBurrH: a new modular DNA binding protein for genome engineering
Supplementary information for: BurrH: a new modular protein for genome engineering Alexandre Juillerat, Claudia Bertonati, Gwendoline Dubois, Valérie Guyot, Séverine Thomas, Julien Valton, Marine Beurdeley,
More informationSupplementary Materials
Supplementary Materials Supplementary Methods Supplementary Discussion Supplementary Figure 1 Calculated frequencies of embryo cells bearing bi-allelic alterations. Targeted indel mutations induced by
More informationIMPROVEMENT OF CRISPR GENE EDITING EFFICIENCY AND BEYONDS
IMPROVEMENT OF CRISPR GENE EDITING EFFICIENCY AND BEYONDS YONGLUN LUO (ALUN) ALUN@BIOMED.AU.DK VIB, NOV. 21. 2017 Associate Professor, Department of Biomedicine, Aarhus University, Denmark Executive Director,
More informationNon-Host Resistance, Near-Host Resistance, or Just Resistance?
Non-Host Resistance, Near-Host Resistance, or Just Resistance? Australian Cereal Rust Control Program Dr Peter Dracatos Plant Breeding Institute Cobbitty Australia Concepts of Non-Host Resistance and Near
More informationSurrogate reporter-based enrichment of cells containing RNA-guided Cas9 nucleaseinduced
Supplementary Data Surrogate reporter-based enrichment of cells containing RNA-guided Cas9 nucleaseinduced mutations Suresh Ramakrishna 1, Seung Woo Cho 2, Sojung Kim 2, Myungjae Song 1, Ramu Gopalappa
More informationTesting Non-Transgenic CRISPR Technology for Wheat Improvement 13 TH IWGS - TULLN, AUSTRIA
Testing Non-Transgenic CRISPR Technology for Wheat Improvement KALI M BRANDT, HILARY L GUNN, BRETT L BUSCHKE, ADAM HEESACKER, NATHALIA MORET TI, ALEXANDER KARASEV, ROBERT S ZEMETRA 13 TH IWGS - TULLN,
More informationCRISPR/Cas9 Mouse Production
CRISPR/Cas9 Mouse Production Emory Transgenic and Gene Targeting Core http://cores.emory.edu/tmc Tamara Caspary, Ph.D. Scientific Director Teresa Quackenbush --- Lab Operations and Communications Coordinator
More informationSupplementary Figure 1. CRISPR/Cas9-induced targeted mutations in TaGASR7, TaDEP1, TaNAC2, TaPIN1, TaLOX2 and TaGW2 genes in wheat protoplasts.
Supplementary Figure 1. CRISPR/Cas9-induced targeted mutations in TaGASR7, TaDEP1, TaNAC2, TaPIN1, TaLOX2 and TaGW2 genes in wheat protoplasts. Lanes 1 and 2: digested CRISPR/Cas9-transformed protoplasts;
More informationMarker types. Potato Association of America Frederiction August 9, Allen Van Deynze
Marker types Potato Association of America Frederiction August 9, 2009 Allen Van Deynze Use of DNA Markers in Breeding Germplasm Analysis Fingerprinting of germplasm Arrangement of diversity (clustering,
More informationLarge chromosomal deletions and heritable small genetic changes induced by CRISPR/Cas9 in rice
Genetics, Development and Cell Biology Publications Genetics, Development and Cell Biology 9-2014 Large chromosomal deletions and heritable small genetic changes induced by CRISPR/Cas9 in rice Martin H.
More informationSupplementary information, Figure S1
Supplementary information, Figure S1 (A) Schematic diagram of the sgrna and hspcas9 expression cassettes in a single binary vector designed for Agrobacterium-mediated stable transformation of Arabidopsis
More informationRefresher on gene expression - DNA: The stuff of life
Plant Pathology 602 Plant-Microbe Interactions Lecture 2 Molecular methods for studying hostpathogen interactions I Sophien Kamoun kamoun.1@osu.edu The Ohio State University Ohio Agricultural Research
More informationMap-Based Cloning of Qualitative Plant Genes
Map-Based Cloning of Qualitative Plant Genes Map-based cloning using the genetic relationship between a gene and a marker as the basis for beginning a search for a gene Chromosome walking moving toward
More informationTransgenic and genomics-assisted breeding approaches to improve durable fungal disease resistance in wheat
Transgenic and genomics-assisted breeding approaches to improve durable fungal disease resistance in wheat Beat Keller, bkeller@botinst.uzh.ch University of Zurich, Switzerland Conference «Novel approaches
More informationCompoZr Transporter Knockout Cell Lines
biotransport CompoZr Transporter Knockout Cell Lines Assessment of Substrates with Functionally Knocked Out Transporters MDR1, BCRP and MRP2 biotransport CompoZr Transporter Knockout Cell Lines The Increasing
More informationSperm cells are passive cargo of the pollen tube in plant fertilization
In the format provided by the authors and unedited. SUPPLEMENTARY INFORMATION VOLUME: 3 ARTICLE NUMBER: 17079 Sperm cells are passive cargo of the pollen tube in plant fertilization Jun Zhang 1, Qingpei
More informationA Guide to CRISPR/Cas9
Genome editing and beyond freepik A Guide to CRISPR/Cas9 The latest advance in genomic DNA editing is the Clustered Regularly Interspaced Short Palindromic Repeat (CRISPR)/Cas9 system. This simple-touse
More informationGENE TECHNOLOGY LEGISLATION
NBTS AND AND AUSTRALIAN GENE TECHNOLOGY LEGISLATION Dr. Michael Dornbusch Office of the Gene Technology Regulator Australia Integrated Regulation of GMOs & GM Products OGTR regulates GMOs. Some overlap
More informationSupplementary Materials for
www.sciencemag.org/cgi/content/full/science.aaa5945/dc1 Supplementary Materials for The mutagenic chain reaction: A method for converting heterozygous to homozygous mutations Valentino M. Gantz* and Ethan
More informationA universal chassis plasmid pwh34 was first constructed to facilitate the
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 File name: Supplementary method Plasmids construction A universal chassis plasmid pwh34 was first constructed to facilitate the construction
More informationEXZACT TM Precision Technology: Scientific and Regulatory Advancements in Plant-Genome Editing with ZFNs
EXZACT TM Precision Technology: Scientific and Regulatory Advancements in Plant-Genome Editing with ZFNs Gary Rudgers and Lakshmi Sastry-Dent Dow AgroSciences Indianapolis, Indiana gwrudgers@gmail.com
More informationResearch Advances in the Development of Transgenic and Gene Edited Products in Sri Lanka
Research Advances in the Development of Transgenic and Gene Edited Products in Sri Lanka Dr. Pradeepa C.G. Bandaranayake Director, Agricultural Biotechnology Centre Faculty of Agriculture University of
More informationEasi CRISPR for conditional and insertional alleles
Easi CRISPR for conditional and insertional alleles C.B Gurumurthy, University Of Nebraska Medical Center Omaha, NE cgurumurthy@unmc.edu Types of Genome edits Gene disruption/inactivation Types of Genome
More informationTRANSGENIC ANIMALS. -transient transfection of cells -stable transfection of cells. - Two methods to produce transgenic animals:
TRANSGENIC ANIMALS -transient transfection of cells -stable transfection of cells - Two methods to produce transgenic animals: 1- DNA microinjection - random insertion 2- embryonic stem cell-mediated gene
More informationExperimental genetics - 2 Partha Roy
Partha Roy Experimental genetics - 2 Making genetically altered animal 1) Gene knock-out k from: a) the entire animal b) selected cell-type/ tissue c) selected cell-type/tissue at certain time 2) Transgenic
More informationApplications of Cas9 nickases for genome engineering
application note genome editing Applications of Cas9 nickases for genome engineering Shuqi Yan, Mollie Schubert, Maureen Young, Brian Wang Integrated DNA Technologies, 17 Commercial Park, Coralville, IA,
More informationMethods for Reverse genetics
Methods for Reverse genetics References: 1. Alonso JM, Ecker JR. Moving forward in reverse: genetic technologies to enable genomewide phenomic screens in Arabidopsis. Nat Rev Genet. 2006 Jul;7(7):524-36.
More informationMidterm 1 Results. Midterm 1 Akey/ Fields Median Number of Students. Exam Score
Midterm 1 Results 10 Midterm 1 Akey/ Fields Median - 69 8 Number of Students 6 4 2 0 21 26 31 36 41 46 51 56 61 66 71 76 81 86 91 96 101 Exam Score Quick review of where we left off Parental type: the
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION doi:10.1038/nature09937 a Name Position Primersets 1a 1b 2 3 4 b2 Phenotype Genotype b Primerset 1a D T C R I E 10000 8000 6000 5000 4000 3000 2500 2000 1500 1000 800 Donor (D)
More informationNature Genetics: doi: /ng Supplementary Figure 1. ChIP-seq genome browser views of BRM occupancy at previously identified BRM targets.
Supplementary Figure 1 ChIP-seq genome browser views of BRM occupancy at previously identified BRM targets. Gene structures are shown underneath each panel. Supplementary Figure 2 pref6::ref6-gfp complements
More informationTALENs and CRISPR/Cas9 for Rice-Genome Editing
TALENs and CRISPR/Cas9 for Rice-Genome Editing Bing Yang Iowa State University Ames, Iowa byang@iastate.edu Rice, Oryza sativa L., is an important staple crop that feeds more than half of the world s population.
More informationUsing CRISPR for genetic alteration
Using CRISPR for genetic alteration Joffrey Mianné. j.mianne@har.mrc.ac.uk Mary Lyon Centre, MRC Harwell. CRISPR/Cas origins Origin of the CRISPR/Cas system: Clustered-Regularly Interspaced Short Palindromic
More informationIntroduction and History of Genome Modification. Adam Clore, PhD Director, Synthetic Biology Design
Introduction and History of Genome Modification Adam Clore, PhD Director, Synthetic Biology Design Early Non-site Directed Genome Modification Homologous recombination in yeast TARGET GENE 5 Arm URA3 3
More informationLentiviral CRISPR guild RNA Cloning Kit for constructing CRISPR targeting grna lentivectors
Lentiviral CRISPR guild RNA Cloning Kit for constructing CRISPR targeting grna lentivectors Cat# Product Name Amount Application grna-h1-gb grna-h1-gp grna-h1-rb grna-h1-rp grna-h1-puro grna-h1-bsd grna-u6-gb
More informationSupplementary Figure 1. Diagram for CATCHA construct. Nature Biotechnology doi: /nbt.3444
Supplementary Figure 1 Diagram for CATCHA construct. Supplementary Figure 2 Representative view of ebony (left) and non-ebony (right) F2 flies from experiments described in Fig. 1c. F0 #1 F0 #2 F0 #3 F0
More informationReturn to Web Version
Page 1 of 7 Page 1 of 7 Return to Web Version ZFN Technology Biowire Volume 10 Article 1 Have your genomic work cut out for you The genomes of several organisms, including humans, have been sequenced,
More informationProtocol for tissue-specific gene disruption in zebrafish
Protocol for tissue-specific gene disruption in zebrafish Overview This protocol describes a method to inactivate genes in zebrafish in a tissue-specific manner. It can be used to analyze mosaic loss-of-function
More informationPatterns and mechanisms of recombination at the barley VRN- H1 locus. James Cockram
Patterns and mechanisms of recombination at the barley VRN- H1 locus James Cockram Talk Outline: Project background Genetic markers used Homologous and non-homologous recombination within BM5A Putative
More informationSupplementary Information
Supplementary Information Super-resolution imaging of fluorescently labeled, endogenous RNA Polymerase II in living cells with CRISPR/Cas9-mediated gene editing Won-Ki Cho 1, Namrata Jayanth 1, Susan Mullen
More informationMouse Engineering Technology. Musculoskeletal Research Center 2016 Summer Educational Series David M. Ornitz Department of Developmental Biology
Mouse Engineering Technology Musculoskeletal Research Center 2016 Summer Educational Series David M. Ornitz Department of Developmental Biology Core service and new technologies Mouse ES core Discussions
More informationUser Instructions:Transfection-ready CRISPR/Cas9 Reagents. Target DNA. NHEJ repair pathway. Nucleotide deletion. Nucleotide insertion Gene disruption
User Instructions:Transfection-ready CRISPR/Cas9 Reagents Background Introduction to CRISPR/Cas9 genome editing In bacteria and archaea, clustered regularly interspaced short palindromic repeats (CRISPR)
More informationSupplemental Data. Zhou et al. (2016). Plant Cell /tpc
Supplemental Figure 1. Confirmation of mutant mapping results. (A) Complementation assay with stably transformed genomic fragments (ComN-N) (2 kb upstream of TSS and 1.5 kb downstream of TES) and CaMV
More informationOutline. ü Post gene expression regulation and RNA editing ü Epigenetic modification
Outline Resources, approaches, technologies, and tools used in functional genomics studies Chemical, physical, and insertional mutagens induced mutations Reverse genetics Site-specific mutation Forward
More informationA barley root mutant collection for NGS-based fast-forward genetics
A barley root mutant collection for NGS-based fast-forward genetics Roberto Tuberosa Dept. of Agricultural Sciences University of Bologna, Italy 2 nd Plant Genomics Congress Kuala Lumpur, 19-20 March,
More informationCRISPR: A Simple Tool for Answering Complex Questions
CRISPR: A Simple Tool for Answering Complex Questions www.bcm.edu/cbass c_bass@bcm.edu 713-798-8987 CRISPR-Cas systems CRISPRs: Clustered Regularly Interspaced Short Palindromic Repeats Cas: The accompanying
More informationMUTANT: A mutant is a strain that has suffered a mutation and exhibits a different phenotype from the parental strain.
OUTLINE OF GENETICS LECTURE #1 A. TERMS PHENOTYPE: Phenotype refers to the observable properties of an organism, such as morphology, growth rate, ability to grow under different conditions or media. For
More informationConcepts: What are RFLPs and how do they act like genetic marker loci?
Restriction Fragment Length Polymorphisms (RFLPs) -1 Readings: Griffiths et al: 7th Edition: Ch. 12 pp. 384-386; Ch.13 pp404-407 8th Edition: pp. 364-366 Assigned Problems: 8th Ch. 11: 32, 34, 38-39 7th
More informationGenome Editing Deals in Agriculture
Genome Editing Deals in Agriculture Key Issues and Potential Pitfalls John R. Therien, J.D. October 24, 2017 Genome Editing Deals in Ag Licensing and R&D collaborations based on GE tools for applications
More informationCRISPR/Cas9 engineering and bioinformatics. Leopold Parts 10/05/2018
CRISPR/Cas9 engineering and bioinformatics Leopold Parts 10/05/2018 CRISPR/Cas9 engineering and bioinformatics CRISPR/Cas9 background Genome engineering in olden days: RE and HR DNA break repair as a basic
More informationNo, because expression of the P elements and hence transposase in suppressed in the F1.
Problem set B 1. A wild-type ry+ (rosy) gene was introduced into a ry mutant using P element-mediated gene transformation, and a strain containing a stable ry+ gene was established. If a transformed male
More informationZebrafish, a model of choice for biomedical research. Yoav Gothilf Dept. Neurobiology, Tel Aviv University
Zebrafish, a model of choice for biomedical research Yoav Gothilf Dept. Neurobiology, Tel Aviv University yoavgothilf@gmail.com https://youtu.be/4c-kw4timva Zebrafish Vertebrate External fertilization
More informationA Multi-purpose Toolkit to Enable Advanced Genome Engineering in Plants
Plant Cell Advance Publication. Published on May 18, 2017, doi:10.1105/tpc.16.00922 LARGE-SCALE BIOLOGY ARTICLE A Multi-purpose Toolkit to Enable Advanced Genome Engineering in Plants Tomáš Čermák 1, Shaun
More informationPlant Physiology Preview. Published on August 12, 2015, as DOI: /pp
Plant Physiology Preview. Published on August 12, 2015, as DOI:10.1104/pp.15.00793 Cas9-gRNA directed genome editing in maize 1 2 3 4 5 6 7 8 9 10 11 12 Cas9-gRNA directed genome editing in maize Corresponding
More informationSupplementary Figure 1. Nature Structural & Molecular Biology: doi: /nsmb.3494
Supplementary Figure 1 Pol structure-function analysis (a) Inactivating polymerase and helicase mutations do not alter the stability of Pol. Flag epitopes were introduced using CRISPR/Cas9 gene targeting
More informationA single meiotic gene, ZIP4, is responsible for the Ph1 locus effect on recombination. Azahara C. Martín John Innes Centre, Norwich, UK
A single meiotic gene, ZIP4, is responsible for the Ph1 locus effect on recombination Azahara C. Martín John Innes Centre, Norwich, UK How to make a better use of the genetic variability within crop species
More informationevaluate risk / benefit implications ascertain applicability of existing legislation
1 Scope & purpose Regulatory implications of NBTs evaluate risk / benefit implications ascertain applicability of existing legislation assess robustness of current regulatory framework and risk analysis
More informationi. This type of DNA damage will result in (circle all correct answers) b. a transversion mutation
Biol 321 Winter 2010 Quiz 5 40 points NAME ANSWERS IN RED COMMENTS IN BLUE 1. (2 pts.) Recall the article entitled: Human Genetic Variation By each statement circle True/False/Not addressed in the paper.
More informationGenome Editing with Programmable Nucleases. Jin-Soo Kim Department of Chemistry Seoul National University
Genome Editing with Programmable Nucleases Jin-Soo Kim Department of Chemistry Seoul National University 1 Method of the Year 2011: Engineered Nucleases RNA-guided Cas9 Endonuclease 3 FokI and the First
More information