SUPPLEMENTARY INFORMATION
|
|
- Kevin Shaw
- 5 years ago
- Views:
Transcription
1 Figure S1 UVRAG amino acid sequence. Bold letters indicate the peptides identified from mass spectrometry analysis. Symbols indicate the prolines in the N-terminal proline-rich sequence (*), the C2 domain (underlined), and the central coiled-coil domain (double underlined). 1
2 Figure S2 UVRAG, Becin1 and Bcl-2 interaction. (a) Native gel. 0.2 nmol of the MBP-UVRAG CCD (lane 1), His 6 -Beclin1 CCD (lane 2), and preformed complex (lane 3) were separated through native gel. (b) SDS-PAGE. 0.2 nmol of MBP-UVRAG CCD-His 6 -Beclin1 CCD preformed complex (lane 3) was recovered by Mono Q column and separated through SDS-PAGE. 0.2 nmol of the MBP-UVRAG CCD (lane 1) and His 6 -Beclin1 CCD (lane 2) were included as controls. (c) vbcl-2 AAA mutant does not interact with PI3KC3. At 48 h posttransfection with GST, GST-vBcl-2, or GST-vBcl-2 AAA construct together with Flag-tagged PI3KC3 and V5-tagged Beclin1, WCL of 293T cells were used for GST pulldown followed by immunoblotting with anti-flag. The raw data for this experiment is presented in the Supplementary information, Fig S5. (d) Triple complex. 0.2 nmol of the MBP-UVRAG CCD, His 6 -Beclin1 CCD, Bcl- XL loop and TM were mixed for 30 min and subjected to amylose column purification. Purified proteins were separated through SDS-PAGE. 2
3 Figure S3 UVRAG-induced Autophagy. (a) Electron microscopic quantitation of autophagosome. Results shown represent the mean ±SEM number of autophagic vacuoles per cell. (b). Essential role of UVRAG in Beclin1- mediated autophagy. HeLa cells were transfected with control sirna or UVRAG-specific sirna together with the GFP-LC3 expression vector. At 24, 48 and 72 h posttransfection, GFP-LC3-positive cells with punctate staining were photographed (top panel) and counted (bottom panel). Autophagy was quantified as the percentage of GFP-positive cells with punctate staining. The scale bars represent 20µm. 3
4 Figure S4 No effect of UVRAG wt and mutants on the viability of HCT116 cells. 1x10 5 HCT116 cells carrying vector, UVRAG wt or its mutants were seeded into 6 well plates and cell viability (%) was determined by counting live cells after trypan blue staining. The results represent means ((SD) of three independent assays. 4
5 Figure S5 Original gel scan. 5
6 Figure S5 Original gel scan. 6
7 Figure S5 Original gel scan. 7
8 Supplemental Data Experimental Procedures Cell Culture HCT116, NIH3T3, HeLa, MCF7 and 293T cells were cultured in Dulbecco's modified Eagle's medium (DMEM) supplemented with 10% fetal bovine serum, 2 mm L-glutamine, 1% penicillin-streptomycin (Gibco-BRL). MCF7.control cells, MCF7.Beclin1 cells and MCF7.Beclin ECD cells were generously provided by Dr. B. Levine and maintained in DMEM supplemented with 10% Tet-system-approved FBS (Clontech), 300 µg/ml hygromycin and 1 µg/ml doxycycline, as described previously 18. Transient transfections were performed with FuGENE 6 (Roche), Lipofectamine 2000 (Invitrogen), or calcium phosphate (Clontech) following the manufacturer s instructions. HCT116 and NIH3T3 stable cell lines were established using a standard protocol of selection with 2 µg/ml of puromycin. Plasmid Construction All constructs for transient gene expression in mammalian cells were derived from pcdna5/frt/to (Invitrogen). A DNA fragment corresponding to the coding sequence of the γhv-68 M11 gene was amplified from S11 cell genomic DNA by polymerase chain reaction (PCR) and subcloned into plasmid pcdna5/frt/to between restriction sites KpnI and NotI or pef-ires-puro between AflII and NotI for selection of stable transfectants. The GST-tagged vbcl-2 sequence was cloned into a pcdna5/frt/to derivative encoding an N-terminal GST epitope tag between BamHI and NotI sites. HA-tagged vbcl-2 and KSHV Bcl-2, the Flag-tagged and HA-tagged versions of both PI3K and UVRAG were cloned between to the KpnI and NotI 1
9 sites of pcdna5/frt/to encoding an N-terminal HA tag or Flag tag. V5-tagged Beclin1 was expressed from a modified pcdna5/frt/to encoding a C-terminal V5 tag; the Belcin1 sequence was inserted between the BamHI and XhoI sites. HA-tagged vbcl-2 AAA mutant was generated by PCR using oligonucleotide-directed mutagenesis to replace serine-85, glycine-86 and arginine-87 with alanine; the PCR product was subcloned into pcdna5/frt/to. Truncated mutants of PI3KC3, UVRAG and Beclin1 were made by subcloning PCR products of cdna fragments containing each separate domain of the associated gene into pcnda5/frt/to. The UVRAG CCD mutant, lacking the coiled-coil domain (aa ), was constructed by twostep PCR directed mutagenesis. All constructs were sequenced using an ABI PRISM 377 automatic DNA sequencer to verify 100% agreement with the original sequence. The HA-tagged Bcl-2 family expression vectors were kindly provided by Dr. M.J. Hardwick (John Hopkins University). pegfp-lc3 and p40px-egfp plasmids were kindly provided by Drs. T. Yoshimori (Osaka University Graduate School of Dentistry) and S. Field (University of California, San Diego), respectively. In vivo GST Pulldown, Protein Purification and Mass Spectrometry To identify vbcl-2-binding proteins, 293T cells expressing GST or GST-vBcl-2 fusion proteins were harvested and lysed with NP40 buffer (50 mm HEPES, ph 7.4, 150 mm NaCl, 1 mm EDTA, 1% (v/v) NP40) supplemented with a complete protease inhibitor cocktail (Roche). Post-centrifuged supernatants were pre-cleared with protein A/G beads at 4 0 C for 2 h. Precleared lysates were mixed with a 50% slurry of glutathione-conjugated Sepharose beads (Amersham Biosciences), and the binding reaction was incubated for 4 h at 4 0 C. Precipitates were washed extensively with lysis buffer. Proteins bound to glutathione beads were eluted and 2
10 separated on a Nupage 4-12% Bis-Tris gradient gel (Invitrogen). After silver staining (Invitrogen), specific protein bands were excised and analyzed by ion-trap mass spectrometry at the Harvard Taplin Biological Mass Spectrometry facility, and amino acid sequences were determined by tandem mass spectrometry and database searches. Immunoblot Analysis and Immunoprecipitation Assay For immunoblotting, polypeptides were resolved by SDS-polyacrylamide gel electrophoresis (PAGE) and transferred to a PVDF membrane (Bio-Rad). Immunodetection was achieved with anti-v5 (1:5000) (Invitrogen), anti-flag (1:5000) (Sigma), anti-ha (1:5000), anti- GST (1:2000) (Santa Cruz Biotech), anti-tubulin (1:1000) (Santa Cruz Biotech), anti-beclin1 (1:500) (BD Bioscience), anti-pi3kc3 (1:250) (Abgent). Rabbit anti-uvrag was diluted 1:500 for immunoblotting. The proteins were visualized by a chemiluminescence reagent (Pierce) and detected by a Fuji Phosphor Imager. For immunoprecipitation, cells were harvested and then lysed in NP40 buffer supplemented with a complete protease inhibitor cocktail (Roche). After pre-clearing with protein A/G agarose beads for 1 h at 4 0 C, whole-cell lysates were used for immunoprecipitation with the indicated antibodies. Generally, 1-4 µg of commercial antibody was added to 1 ml of cell lysate, which was incubated at 4 0 C for 8 to 12 h. After addition of protein A/G agarose beads, the incubation was continued for 1 h. Immunoprecipitates were extensively washed with lysis buffer and eluted with SDS loading buffer by boiling for 5 min Protein Stability 3
11 At 24 h posttransfection with Beclin1 with UVRAG, 293T cells were treated with 20 µg/ml cycloheximide for 8 h. At each time point, cells were collected and subjected to immunoblotting with anti-flag or anti-tubulin. Production of recombinant Beclin1 CCD and UVRAG CCD. The constructs were generated based on a standard polymerase chain reaction protocol. Beclin1 CCD (residues ) and UVRAG CCD (residues ) were expressed in the bacterial strain BL21 (DE3) (Novagen) individually using the vectors pproex Hta (Invitrogen) and a modified pmal-c2 (New England Biolabs), respectively, or co-expressed using a vector construct containing Trc or Tac promoter at the upstream of each gene segment. Beclin1 CCD and UVRAG CCD contained a His 6 tag and a His 6 -fused MBP tag, respectively, at the N- terminus of each protein. Two proteins were individually purified using Ni-NTA columns (Novagen), and the complex of both proteins produced by coexpression was purified using amylose resin (New England Biolabs) and further purified using a Mono Q column (Amersham Pharmacia) after cleaving the tags with TEV protease. Circular dichroism spectroscopy. Data were collected on a JASCO J-810. CD spectrum was recorded with the preformed Beclin1 CCD and UVRAG CCD complex (2.5 M) in 20 mm phosphate buffer (ph 7.5) at 25 o C over the range of nm in a nitrogen atmosphere. The spectrum was the accumulation of three scans corrected by subtracting signals from the buffer control. Lysosomal volume and enzymatic assay 4
12 To measure the lysosomal volume, cells were dissociated with cell dissociation buffer (Sigma) and labeled with LysoTracker Green DND-26 (LTR; 50nM; Molecular Probes) for 45min 37 C, followed by flow cytometry analysis. Lysosomal acid phosphatase activity was assayed using 4- methylumbelliferyl phosphate (4-MUP) substrates. HCT116 cells were lysed with enzyme lysis buffer (50mM Tris-HCL ph 7.4, 1% Triton-X100, 300mM NaCl) supplemented with a complete protease inhibitor cocktail (Roche). The supernatants were incubated at 37 C for 60-90min with 1mM 4-MUP substrate in 0.1M sodium acetate buffer (Ph 4.5), the reaction was stopped by the addition of 0.5M glycine buffer ph 10.3, and the fluorescence was measured at excitation 355nm/ emission 460nm. Characterization of Cell Growth In Vitro HCT116 cells ( ) or NIH3T3 cells ( ) were plated into 6-well microtiter plates. Cell numbers were counted with a hemocytometer (Beckman Coulter) at each time point for 10 days. Cell counts were performed in triplicate. Soft Agar Colony Formation Assay To evaluate anchorage-independent colony formation, HCT116.vector, HCT116.UVRAG, HCT116.UVRAG CCD or HCT116.UVRAG CCD cells ( ) were suspended in complete medium containing 0.3% Nobel agar (Difco) supplemented with 2 µg/ml puromycin and plated in 6-well plates over a basal layer of complete medium containing 0.5% agar. Colonies were scored 10 days after plating and were photographed by phase-contrast microscopy. Images were captured with the QCapture software program. Clonogenicity was determined in repeated experiments. 5
13 Tumorigenicity in Nude Mice Nude mice were subcutaneously injected with HCT116.vector, HCT116.UVRAG or HCT116.UVRAG CCD cells. At 16 days postinoculation, mice were euthanized, and their tumors were weighed. 6
Supplementary Information: Materials and Methods. Immunoblot and immunoprecipitation. Cells were washed in phosphate buffered
Supplementary Information: Materials and Methods Immunoblot and immunoprecipitation. Cells were washed in phosphate buffered saline (PBS) and lysed in TNN lysis buffer (50mM Tris at ph 8.0, 120mM NaCl
More informationSupplementary data. sienigma. F-Enigma F-EnigmaSM. a-p53
Supplementary data Supplemental Figure 1 A sienigma #2 sienigma sicontrol a-enigma - + ++ - - - - - - + ++ - - - - - - ++ B sienigma F-Enigma F-EnigmaSM a-flag HLK3 cells - - - + ++ + ++ - + - + + - -
More informationSupplementary Information: Materials and Methods. GST and GST-p53 were purified according to standard protocol after
Supplementary Information: Materials and Methods Recombinant protein expression and in vitro kinase assay. GST and GST-p53 were purified according to standard protocol after induction with.5mm IPTG for
More informationRNA oligonucleotides and 2 -O-methylated oligonucleotides were synthesized by. 5 AGACACAAACACCAUUGUCACACUCCACAGC; Rand-2 OMe,
Materials and methods Oligonucleotides and DNA constructs RNA oligonucleotides and 2 -O-methylated oligonucleotides were synthesized by Dharmacon Inc. (Lafayette, CO). The sequences were: 122-2 OMe, 5
More informationSUPPLEMENTARY INFORMATION
The Supplementary Information (SI) Methods Cell culture and transfections H1299, U2OS, 293, HeLa cells were maintained in DMEM medium supplemented with 10% fetal bovine serum. H1299 and 293 cells were
More informationFig. S1. CrgA intracellular levels in M. tuberculosis. Ten and twenty micrograms of
Supplementary data Fig. S1. CrgA intracellular levels in M. tuberculosis. Ten and twenty micrograms of cell free protein lysates from WT M. tuberculosis (Rv) together with various known concentrations
More informationSupplemental Data. LMO4 Controls the Balance between Excitatory. and Inhibitory Spinal V2 Interneurons
Neuron, Volume 61 Supplemental Data LMO4 Controls the Balance between Excitatory and Inhibitory Spinal V2 Interneurons Kaumudi Joshi, Seunghee Lee, Bora Lee, Jae W. Lee, and Soo-Kyung Lee Supplemental
More informationSupplemental Information. Pacer Mediates the Function of Class III PI3K. and HOPS Complexes in Autophagosome. Maturation by Engaging Stx17
Molecular Cell, Volume 65 Supplemental Information Pacer Mediates the Function of Class III PI3K and HOPS Complexes in Autophagosome Maturation by Engaging Stx17 Xiawei Cheng, Xiuling Ma, Xianming Ding,
More informationSupplemental Information
Supplemental Information Intrinsic protein-protein interaction mediated and chaperonin assisted sequential assembly of a stable Bardet Biedl syndome protein complex, the BBSome * Qihong Zhang 1#, Dahai
More informationSupplementary Figure S1. Growth patterns of WT and siz1-2 plants and the effect of different nitrogen sources on their growth. After germination on
Supplementary Figure S1. Growth patterns of WT and siz1-2 plants and the effect of different nitrogen sources on their growth. After germination on MS media, seedlings were transferred to soil and treated
More informationSupplementary Figure 1 - Characterization of rbag3 binding on macrophages cell surface.
Supplementary Figure 1 - Characterization of rbag3 binding on macrophages cell surface. (a) Human PDAC cell lines were treated as indicated in Figure 1 panel F. Cells were analyzed for FITC-rBAG3 binding
More informationSupplementary information
Supplementary information The E3 ligase RNF8 regulates KU80 removal and NHEJ repair Lin Feng 1, Junjie Chen 1 1 Department of Experimental Radiation Oncology, The University of Texas M. D. Anderson Cancer
More informationSUPPLEMENTARY INFORMATION
R2A MASNSEKNPLL-SDEKPKSTEENKSS-KPESASGSSTSSAMP---GLNFNAFDFSNMASIL 56 R2B MASSSEKTPLIPSDEKNDTKEESKSTTKPESGSGAPPSPS-PTDPGLDFNAFDFSGMAGIL 60 R2A NDPSIREMAEQIAKDPAFNQLAEQLQRSIPNAGQEGGFPNFDPQQYVNTMQQVMHNPEFK
More informationSupplementary Information
Journal : Nature Biotechnology Supplementary Information Targeted genome engineering in human cells with RNA-guided endonucleases Seung Woo Cho, Sojung Kim, Jong Min Kim, and Jin-Soo Kim* National Creative
More informationBACTERIAL PRODUCTION EXPRESSION METHOD OVERVIEW: PEF # GENE NAME EXPRESSION VECTOR MOLECULAR WEIGHT kda (full-length) 34.
BACTERIAL PRODUCTION PEF # GENE NAME EXPRESSION VECTOR MOLECULAR WEIGHT 2015-XXXX XXXX pet-32a 50.9 kda (full-length) 34.0 kda (cleaved) EXPRESSION METHOD OVERVIEW: Plasmid DNA was transformed into BL21
More informationsupplementary information
DOI: 1.138/ncb1839 a b Control 1 2 3 Control 1 2 3 Fbw7 Smad3 1 2 3 4 1 2 3 4 c d IGF-1 IGF-1Rβ IGF-1Rβ-P Control / 1 2 3 4 Real-time RT-PCR Relative quantity (IGF-1/ mrna) 2 1 IGF-1 1 2 3 4 Control /
More informationAnalysing protein protein interactions using a GST-fusion protein to pull down the interacting target from the cell lysate Hong Wang and Xin Zeng
Analysing protein protein interactions using a GST-fusion protein to pull down the interacting target from the cell lysate Hong Wang and Xin Zeng Department of Molecular Genetics, Biochemistry and Microbiology,
More informationRNA was isolated using NucleoSpin RNA II (Macherey-Nagel, Bethlehem, PA) according to the
Supplementary Methods RT-PCR and real-time PCR analysis RNA was isolated using NucleoSpin RNA II (Macherey-Nagel, Bethlehem, PA) according to the manufacturer s protocol and quantified by measuring the
More information5.2 Protein purification
Purification of a His 6 -tagged Green Fluorescent Protein (GFP). Protein purification.. Purification of a His 6 -tagged Green Fluorescent Protein (GFP) Principle You can add either a N- or C-terminal His
More informationSupplemental Online Material. The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/-
#1074683s 1 Supplemental Online Material Materials and Methods Cell lines and tissue culture The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/- knock-out animals
More informationSupplementary Materials and Methods
Supplementary Materials and Methods sirna sequences used in this study The sequences of Stealth Select RNAi for ALK and FLOT-1 were as follows: ALK sense no.1 (ALK): 5 -AAUACUGACAGCCACAGGCAAUGUC-3 ; ALK
More informationtranscription and the promoter occupancy of Smad proteins. (A) HepG2 cells were co-transfected with the wwp-luc reporter, and FLAG-tagged FHL1,
Supplementary Data Supplementary Figure Legends Supplementary Figure 1 FHL-mediated TGFβ-responsive reporter transcription and the promoter occupancy of Smad proteins. (A) HepG2 cells were co-transfected
More informationColeman et al., Supplementary Figure 1
Coleman et al., Supplementary Figure 1 BrdU Merge G1 Early S Mid S Supplementary Figure 1. Sequential destruction of CRL4 Cdt2 targets during the G1/S transition. HCT116 cells were synchronized by sequential
More informationT H E J O U R N A L O F C E L L B I O L O G Y
T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Nakajima and Tanoue, http://www.jcb.org/cgi/content/full/jcb.201104118/dc1 Figure S1. DLD-1 cells exhibit the characteristic morphology
More informationpt7ht vector and over-expressed in E. coli as inclusion bodies. Cells were lysed in 6 M
Supplementary Methods MIG6 production, purification, inhibition, and kinase assays MIG6 segment 1 (30mer, residues 334 364) peptide was synthesized using standard solid-phase peptide synthesis as described
More informationSupplementary methods
Supplementary methods Cell culture, infection, transfection, and RNA interference HEK293 cells and its derivatives were grown in DMEM supplemented with 10% FBS. Various constructs were introduced into
More informationProtocol for induction of expression and cell lysate production
Protocol for induction of expression and cell lysate production AV-04 Doxycyclin induction and cell lysate 1.0 Introduction / Description This method is intended for the treatment of the previously transfected
More informationFig. S1. Effect of p120-catenin overexpression on the interaction of SCUBE2 with E-cadherin. The expression plasmid encoding FLAG.
Fig. S1. Effect of p120-catenin overexpression on the interaction of SCUBE2 with E-cadherin. The expression plasmid encoding FLAG.SCUBE2, E-cadherin.Myc, or HA.p120-catenin was transfected in a combination
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature09732 Supplementary Figure 1: Depletion of Fbw7 results in elevated Mcl-1 abundance. a, Total thymocytes from 8-wk-old Lck-Cre/Fbw7 +/fl (Control) or Lck-Cre/Fbw7 fl/fl (Fbw7 KO) mice
More informationLecture 8: Affinity Chromatography-III
Lecture 8: Affinity Chromatography-III Key words: Chromatography; Affinity chromatography; Protein Purification During this lecture, we shall be studying few more examples of affinity chromatography. The
More informationSupporting Information for: DNA-based delivery vehicles: ph-controlled disassembly and cargo release by Jung-Won Keum and Harry Bermudez
Supporting Information for: DNA-based delivery vehicles: ph-controlled disassembly and cargo release by Jung-Won Keum and Harry Bermudez DNA sequences Strand Sequence 1- GGGTTAGGGTTAGGGTTAGGGAGGGTTAGGGTTAGGGTTAGGGAGGGTTAGGGTTAGGGTTAGGG
More informationSupporting Information
Supporting Information Su et al. 10.1073/pnas.1211604110 SI Materials and Methods Cell Culture and Plasmids. Tera-1 and Tera-2 cells (ATCC: HTB- 105/106) were maintained in McCoy s 5A medium with 15% FBS
More informationLINGO-1, A TRANSMEMBRANE SIGNALING PROTEIN, INHIBITS OLIGODENDROCYTE DIFFERENTIATION AND MYELINATION THROUGH INTERCELLULAR SELF- INTERACTIONS.
Supplemental Data: LINGO-1, A TRANSMEMBRANE SIGNALING PROTEIN, INHIBITS OLIGODENDROCYTE DIFFERENTIATION AND MYELINATION THROUGH INTERCELLULAR SELF- INTERACTIONS. Scott Jepson, Bryan Vought, Christian H.
More informationsupplementary information
DOI: 10.1038/ncb2116 Figure S1 CDK phosphorylation of EZH2 in cells. (a) Comparison of candidate CDK phosphorylation sites on EZH2 with known CDK substrates by multiple sequence alignments. (b) CDK1 and
More information(Supplementary Methods online)
(Supplementary Methods online) Production and purification of either LC-antisense or control molecules Recombinant phagemids and the phagemid vector were transformed into XL-1 Blue competent bacterial
More informationSupplemental Information
Supplemental Information ATP-dependent unwinding of U4/U6 snrnas by the Brr2 helicase requires the C-terminus of Prp8 Corina Maeder 1,3, Alan K. Kutach 1,2,3, and Christine Guthrie 1 1 Department of Biochemistry
More informationSUPPLEMENTARY INFORMATION FIGURE 1 - 1
SUPPLEMENTARY INFORMATION FIGURE 1-1 SUPPLEMENTARY INFORMATION FIGURE 2-2 SUPPLEMENTARY INFORMATION METHODS GST-Pull-Down. Cultures of E. Coli (BL21) were transformed with pgex (Clontech) and pgex recombinant
More informationSupporting Information
Supporting Information Krieg et al. 10.1073/pnas.0907131106 SI Text Reagents. Recombinant human TNF- was from Peprotech. Monoclonal rat anti-rip2 was purchased from Alexis, whereas monoclonal mouse anti-xiap
More informationSupplementary Information (Ha, et. al) Supplementary Figures Supplementary Fig. S1
Supplementary Information (Ha, et. al) Supplementary Figures Supplementary Fig. S1 a His-ORMDL3 ~ 17 His-ORMDL3 GST-ORMDL3 - + - + IPTG GST-ORMDL3 ~ b Integrated Density (ORMDL3/ -actin) 0.4 0.3 0.2 0.1
More informationyellow protein turn off/on label (POOL) , Republic of Korea The PYP gene was subcloned in the pqe80l vector using EZ-Cloning (enzynomics ).
Supporting Information High-throughput instant quantification of protein expression and purity based on photoactive yellow protein turn off/on label (POOL) Youngmin Kim 1,2, Prabhakar Ganesan 1,2 and Hyotcherl
More informationArf6 Activation Assay Kit
A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Arf6 Activation Assay Kit Catalog Number: 82401 20 assays NewEast Biosciences 1 Table of Content Product
More informationSupplementary Materials
Supplementary Materials Supplementary Figure 1. PKM2 interacts with MLC2 in cytokinesis. a, U87, U87/EGFRvIII, and HeLa cells in cytokinesis were immunostained with DAPI and an anti-pkm2 antibody. Thirty
More informationSupplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling
Supplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling Glendining KA 1, Markie D 2, Gardner RJM 4, Franz EA 3, Robertson SP 4, Jasoni CL 1 Supplementary
More informationRapid and sensitive determination of recombinant protein expression
APPLIAION NOE Pro-Detect Rapid assays Rapid and sensitive determination of recombinant protein expression Introduction Recombinant protein expression and purification is a multistep process that includes:
More informationSupplementary Material
Supplementary Material Supplementary Methods Cell synchronization. For synchronized cell growth, thymidine was added to 30% confluent U2OS cells to a final concentration of 2.5mM. Cells were incubated
More informationRheB Activation Assay Kit
A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based RheB Activation Assay Kit Catalog Number: 81201 20 assays NewEast Biosciences 1 FAX: 610-945-2008 Table
More informationApoptosis And Anti-tumor Effect Induced By Mtor Inhibitor And Autophagy Inhibitor In Human Osteosarcoma Cells
Apoptosis And Anti-tumor Effect Induced By Mtor Inhibitor And Autophagy Inhibitor In Human Osteosarcoma Cells Ryosuke Horie. Kagawa University of medecine, Kita-gun, Japan. Disclosures: R. Horie: None.
More informationAt E17.5, the embryos were rinsed in phosphate-buffered saline (PBS) and immersed in
Supplementary Materials and Methods Barrier function assays At E17.5, the embryos were rinsed in phosphate-buffered saline (PBS) and immersed in acidic X-gal mix (100 mm phosphate buffer at ph4.3, 3 mm
More informationFigure 1: TDP-43 is subject to lysine acetylation within the RNA-binding domain a) QBI-293 cells were transfected with TDP-43 in the presence or
Figure 1: TDP-43 is subject to lysine acetylation within the RNA-binding domain a) QBI-293 cells were transfected with TDP-43 in the presence or absence of the acetyltransferase CBP and acetylated TDP-43
More information1. Cross-linking and cell harvesting
ChIP is a powerful tool that allows the specific matching of proteins or histone modifications to regions of the genome. Chromatin is isolated and antibodies to the antigen of interest are used to determine
More informationSupporting Online Material for
www.sciencemag.org/cgi/content/full/1137999/dc1 Supporting Online Material for Disrupting the Pairing Between let-7 and Enhances Oncogenic Transformation Christine Mayr, Michael T. Hemann, David P. Bartel*
More informationSupplementary Figure S1 Purification of deubiquitinases HEK293 cells were transfected with the indicated DUB-expressing plasmids.
Supplementary Figure S1 Purification of deubiquitinases HEK293 cells were transfected with the indicated DUB-expressing plasmids. The cells were harvested 72 h after transfection. FLAG-tagged deubiquitinases
More informationPROCEDURE FOR USE NICKEL NTA Magnetic Agarose Beads (5%)
1 AFFINITY HIS-TAG PURIFICATION PROCEDURE FOR USE NICKEL NTA Magnetic Agarose Beads (5%) DESCRIPTION Nickel NTA Magnetic Agarose Beads are products that allow rapid and easy small-scale purification of
More informationAnna A. Sablina, Wen Chen, Jason D. Arroyo, Laura Corral, Melissa Hector, Sara E. Bulmer, James A. DeCaprio, and William C. Hahn
Cell, Volume 129 Supplemental Data The Tumor Suppressor PP2A Aβ Regulates the RalA GTPase Anna A. Sablina, Wen Chen, Jason D. Arroyo, Laura Corral, Melissa Hector, Sara E. Bulmer, James A. DeCaprio, and
More informationGlutathione Resin. (Cat. # , , , ) think proteins! think G-Biosciences
191PR 05 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name Glutathione Resin (Cat. # 786 280, 786 310, 786 311, 786 312) think proteins! think
More informationRab5 Activation Assay Kit
A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Rab5 Activation Assay Kit Catalog Number: 83701 20 assays 24 Whitewoods Lane 1 Table of Content Product
More informationFor Research Use Only. Not for use in diagnostic procedures.
Printed December 13, 2011 Version 1.0 For Research Use Only. Not for use in diagnostic procedures. DDDDK-tagged Protein PURIFICATION GEL with Elution Peptide (MoAb. clone FLA-1) CODE No. 3326 / 3327 PURIFICATION
More informationSupplementary Information
Supplementary Information Supplementary Figures Figure S1. Study of mgtl translation in vitro. (A) Detection of 5 LR RNA using wild-type and anti-sd (91-95) substituted templates in a transcription-translation
More informationCdc42 Activation Assay Kit
A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Cdc42 Activation Assay Kit Catalog Number: 80701 20 assays 1 Table of Content Product Description 3 Assay
More informationChangsong Yang, Martin Pring, Martin A. Wear, Minzhou Huang, John A. Cooper, Tatyana M. Svitkina, Sally H. Zigmond
Mammalian CARMIL Inhibits Actin Filament Capping by Capping Protein Changsong Yang, Martin Pring, Martin A. Wear, Minzhou Huang, John A. Cooper, Tatyana M. Svitkina, Sally H. Zigmond Supplemental Experimental
More informationMolecular Cloning. Joseph Sambrook. David W. Russell A LABORATORY MANUAL COLD SPRING HARBOR LABORATORY PRESS VOLUME.
VOLUME Molecular Cloning A LABORATORY MANUAL THIRD EDITION www.molecularcloning.com Joseph Sambrook PETER MACCALLUM CANCER INSTITUTE AND THE UNIVERSITY OF MELBOURNE, AUSTRALIA David W. Russell UNIVERSITY
More informationSupplementary Figure 1 Phosphorylated tau accumulates in Nrf2 (-/-) mice. Hippocampal tissues obtained from Nrf2 (-/-) (10 months old, 4 male; 2
Supplementary Figure 1 Phosphorylated tau accumulates in Nrf2 (-/-) mice. Hippocampal tissues obtained from Nrf2 (-/-) (10 months old, 4 male; 2 female) or wild-type (5 months old, 1 male; 11 months old,
More informationCell culture and drug treatment. HEK 293 cells were cultured in DMEM (Gibco-BRL)
Supplementary materials Detailed methods Cell culture and drug treatment. HEK 293 cells were cultured in DMEM (Gibco-BRL) supplemented with 10% fetal bovine serum. To inhibit glucosidase Ι and ΙΙ, castanospermine
More informationSupplementary methods Shoc2 In Vitro Ubiquitination Assay
Supplementary methods Shoc2 In Vitro Ubiquitination Assay 35 S-labelled Shoc2 was prepared using a TNT quick Coupled transcription/ translation System (Promega) as recommended by manufacturer. For the
More informationGST Elution Buffer. (Cat. # ) think proteins! think G-Biosciences
191PR-05 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name GST Elution Buffer (Cat. #786-541) think proteins! think G-Biosciences www.gbiosciences.com
More informationSupplementary Information
Supplementary Information Supplementary Figure 1: Over-expression of CD300f in NIH3T3 cells enhances their capacity to phagocytize AC. (a) NIH3T3 cells were stably transduced by EV, CD300f WT or CD300f
More informationA protein-polymer hybrid gene carrier based on thermophilic histone. and polyethylenimine
Electronic Supplementary Material (ESI) for New Journal of Chemistry. This journal is The Royal Society of Chemistry and the Centre National de la Recherche Scientifique 2015 A protein-polymer hybrid gene
More informationSUPPLEMENTARY INFORMATION
(Supplementary Methods and Materials) GST pull-down assay GST-fusion proteins Fe65 365-533, and Fe65 538-700 were expressed in BL21 bacterial cells and purified with glutathione-agarose beads (Sigma).
More informationGα i Activation Assay Kit
A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Gα i Activation Assay Kit Catalog Number 80301 20 assays NewEast Biosciences, Inc 1 Table of Content Product
More informationNguyen et al., Supplemental Figures, Methods and References Supplemental Figures
Nguyen et al., Supplemental Figures, Methods and References Supplemental Figures Supplemental Figure 1. Additional analyses of genome-wide shrna screen for liver colonization and survival in culture (A)
More informationSupporting Information
Supporting Information Development of a 2,4-Dinitrotoluene-Responsive Synthetic Riboswitch in E. coli cells Molly E. Davidson, Svetlana V. Harbaugh, Yaroslav G. Chushak, Morley O. Stone, Nancy Kelley-
More informationStrep-Spin Protein Miniprep Kit Catalog No. P2004, P2005
INSTRUCTION MANUAL Strep-Spin Protein Miniprep Kit Catalog No. P2004, P2005 Highlights Fast protocol to purify Strep-tagged proteins from cell-free extracts Screen your recombinant colonies directly for
More informationRegulation of autophagic activity by ζ proteins associated with class III. phosphatidylinositol-3 kinase. Mercedes Pozuelo Rubio
ONLINE SUPPORTING INFORMATION Regulation of autophagic activity by 14-3-3ζ proteins associated with class III phosphatidylinositol-3 kinase Mercedes Pozuelo Rubio entro Andaluz de Biología Molecular y
More informationSupplemental Materials and Methods
Supplemental Materials and Methods Co-immunoprecipitation (Co-IP) assay Cells were lysed with NETN buffer (20 mm Tris-HCl, ph 8.0, 0 mm NaCl, 1 mm EDT, 0.5% Nonidet P-40) containing 50 mm β-glycerophosphate,
More informationStabilization of a virus-like particle and its application as a nanoreactor at physiological conditions
Supporting Information Stabilization of a virus-like particle and its application as a nanoreactor at physiological conditions Lise Schoonen, b Sjors Maassen, b Roeland J. M. Nolte b and Jan C. M. van
More informationSupporting Information
Supporting Information He et al. 10.1073/pnas.1116302108 SI Methods Cell Culture. Mouse J774A.1 and RAW 264.7 macrophages were obtained from ATCC and were cultured in MEM supplemented with 10% FS (Sigma)
More informationSupplementary Online Material
Material and Methods Supplementary Online Material Reagents and antibodies Wortmannin, JNK inhibitor II (Anthra[1,9-cd]pyrazol-6(2H)-one 1,9-pyrazoloanthrone), SB 2358, and PD 9859 were purchased from
More informationSupplementary information
Supplementary information Table of Content: Supplementary Results... 2 Supplementary Figure S1: Experimental validation of AP-MS results by coimmunprecipitation Western blot analysis.... 3 Supplementary
More informationSupplementary Table 1. The Q-PCR primer sequence is summarized in the following table.
Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table. Name Sequence (5-3 ) Application Flag-u ggactacaaggacgacgatgac Shared upstream primer for all the amplifications of
More informationBcl-2 family member Bcl-G is not a pro-apoptotic BH3-only protein
Bcl-2 family member Bcl-G is not a pro-apoptotic BH3-only protein Maybelline Giam 1,2, Toru Okamoto 1,2,3, Justine D. Mintern 1,2,4, Andreas Strasser 1,2 and Philippe Bouillet 1, 2 1 The Walter and Eliza
More informationGlutathione Resin. (Cat. # , , , ) think proteins! think G-Biosciences
191PR-05 G-Biosciences 1-800-628-7730 1-314-991-6034 technical@gbiosciences.com A Geno Technology, Inc. (USA) brand name Glutathione Resin (Cat. # 786-280, 786-310, 786-311, 786-312) think proteins! think
More informationSupplementary Fig. 1. Schematic structure of TRAIP and RAP80. The prey line below TRAIP indicates bait and the two lines above RAP80 highlight the
Supplementary Fig. 1. Schematic structure of TRAIP and RAP80. The prey line below TRAIP indicates bait and the two lines above RAP80 highlight the prey clones identified in the yeast two hybrid screen.
More informationSupporting Online Material for
www.sciencemag.org/cgi/content/full/1154040/dc1 Supporting Online Material for Selective Blockade of MicroRNA Processing by Lin-28 Srinivas R. Viswanathan, George Q. Daley,* Richard I. Gregory* *To whom
More informationSupplemental Data. Lee et al. Plant Cell. (2010) /tpc Supplemental Figure 1. Protein and Gene Structures of DWA1 and DWA2.
Supplemental Figure 1. Protein and Gene Structures of DWA1 and DWA2. (A) Protein structures of DWA1 and DWA2. WD40 region was determined based on the NCBI conserved domain databases (B, C) Schematic representation
More informationSupplemental Materials and Methods:
Supplemental Materials and Methods: Cloning: Oligonucleotides used in the subcloning steps are listed in Supplemental Table 1. Human FANCI (isoform 1, KIAA1794) was subcloned from pcmv6-xl4 [FANCI] in
More informationSUPPLEMENTARY METHODS Peptides HPLC purified peptides from GL Biochem (Shanghai, China): mthsp75-k332, RYTLHY(acetyl-K)TDAPLN; PDH-K81, KADQLY(acetyl-K)QKFIRG; NADH-DH-K243, IENAYK(acetyl-K)TFLPE; ANPtransloc2-K268,
More informationIgG TrueBlot Protocol for Mouse, Rabbit or Goatderived Antibodies - For Research Use Only
IgG TrueBlot Protocol for Mouse, Rabbit or Goatderived Antibodies - For Research Use Only Introduction The IgG TrueBlot for mouse, rabbit, or goat-derived antibodies represents unique series of respective
More informationFor Research Use Only. Not for use in diagnostic procedures. Anti-NRF2 mab
Page 1 For Research Use Only. Not for use in diagnostic procedures. Anti-NRF2 mab CODE No. M200-3 CLONALITY CLONE ISOTYPE QUANTITY SOURCE IMMUNOGEN FORMURATION STORAGE Monoclonal 1F2 Mouse IgG1 100 L,
More informationSupplementary information
Supplementary information Identification of E-cadherin signature sites functioning as cleavage sites for Helicobacter pylori HtrA Thomas P. Schmidt 1*, Anna M. Perna 2*, Tim Fugmann 3, Manja Böhm 4, Jan
More informationSarker et al. Supplementary Material. Subcellular Fractionation
Supplementary Material Subcellular Fractionation Transfected 293T cells were harvested with phosphate buffered saline (PBS) and centrifuged at 2000 rpm (500g) for 3 min. The pellet was washed, re-centrifuged
More informationSUPPLEMENTAL MATERIALS SIRTUIN 1 PROMOTES HYPEROXIA-INDUCED LUNG EPITHELIAL DEATH INDEPENDENT OF NRF2 ACTIVATION
SUPPLEMENTAL MATERIALS SIRTUIN PROMOTES HYPEROXIA-INDUCED LUNG EPITHELIAL DEATH INDEPENDENT OF NRF ACTIVATION Haranatha R. Potteti*, Subbiah Rajasekaran*, Senthilkumar B. Rajamohan*, Chandramohan R. Tamatam,
More informationSupporting Information
Supporting Information Deng et al. 10.1073/pnas.1515692112 SI Materials and Methods FPLC. All fusion proteins were expressed and purified through a three-step FPLC purification protocol, as described (20),
More informationSERVA Ni-NTA Magnetic Beads
INSTRUCTION MANUAL SERVA Ni-NTA Magnetic Beads Magnetic beads for Affinity Purification of His-Tag Fusion Proteins (Cat. No. 42179) SERVA Electrophoresis GmbH - Carl-Benz-Str. 7-69115 Heidelberg Phone
More informationSequence of C-terminal tail regions of myosin heavy chains in class XI of Nicotiana benthamiana (Nb
Fig. S1 Sequence of C-terminal tail regions of myosin heavy chains in class XI of Nicotiana benthamiana (Nb myosin XI-2, -F and K) and BY-2 cell (Nt 170-kD myosin and Nt 175-kD myosin). Amino acids identical
More informationT H E J O U R N A L O F C E L L B I O L O G Y
T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Han et al., http://www.jcb.org/cgi/content/full/jcb.201311007/dc1 Figure S1. SIVA1 interacts with PCNA. (A) HEK293T cells were transiently
More informationSupplementary Figure 1. α-synuclein is truncated in PD and LBD brains. Nature Structural & Molecular Biology: doi: /nsmb.
Supplementary Figure 1 α-synuclein is truncated in PD and LBD brains. (a) Specificity of anti-n103 antibody. Anti-N103 antibody was coated on an ELISA plate and different concentrations of full-length
More informationJCB Online Supplemental Material
JCB Online Supplemental Material Schinzel et al. Results At least one positive charge at the very COOH terminus is needed for mitochondrial sorting It has been reported that two consecutive positive charges
More informationAntibodies against PCNA were previously described [1]. To deplete PCNA from Xenopus egg
Supplementary information Supplementary methods PCNA antibody and immunodepletion Antibodies against PCNA were previously described [1]. To deplete PCNA from Xenopus egg extracts, one volume of protein
More informationComparison of different methods for purification analysis of a green fluorescent Strep-tag fusion protein. Application
Comparison of different methods for purification analysis of a green fluorescent Strep-tag fusion protein Application Petra Sebastian Meike Kuschel Stefan Schmidt Abstract This Application Note describes
More information