(phosphatase tensin) domain is shown in dark gray, the FH1 domain in black, and the

Size: px
Start display at page:

Download "(phosphatase tensin) domain is shown in dark gray, the FH1 domain in black, and the"

Transcription

1 Supplemental Figure 1. Predicted Domain Organization of the AFH14 Protein. (A) Schematic representation of the predicted domain organization of AFH14. The PTEN (phosphatase tensin) domain is shown in dark gray, the FH1 domain in black, and the FH2 domain in light gray. (B) The full-length amino acid (aa) sequence of AFH14. Structural analysis of this sequence indicated the presence of an amino-terminal PTEN-related domain (double line), and two other common structural features, the FH1 domain (dotted line), which is rich in proline (bold), and the highly-conserved FH2 1

2 domain (underlined). The antigen sequence ( aa) used to generate monoclonal antibodies for in vivo localization of AFH14 is shown in the gray box. 2

3 Supplemental Figure 2. Differences between the Amplified and Predicted AFH14 Coding Sequences (CDS). Comparison of the amplified AFH14 CDS and the predicted CDS from TAIR was performed using DNAMAN software. A 591 bp sequence in the FH1 domain predicted by TAIR was absent in the CDS of amplified AFH14. The figure shows the distinct region from sequence alignment, and the numbering is based on the predicted sequence from TAIR. 3

4 Supplemental Figure 3. FH1FH2 and AFH14 are Specifically Recognized by Polyclonal and Monoclonal AFH14 Antibody, Respectively. (A) Purification of recombinant FH1FH2 and characterization of the anti-afh14 polyclonal antibody. Lane 1 contains purified FH1FH2 protein, which corresponds to the major band of approximately 80 kda. The band was visualized by Coomassie Blue staining. Lane 2 shows recombinant FH1FH2 stained with polyclonal anti-afh14 antibodies (1:1000). (B) The specificity of the AFH14 monoclonal antibody was assessed by immunoblotting. Lane 1 contains protein extract from a 10-day-old wildtype seedling. Lane 2 contains protein extract from a 10-day-old afh14-1 seedling. The arrow indicates a band corresponding to the AFH14 protein in Lane 1 that is absent in Lane 2, demonstrating the specificity of the monoclonal antibody. 4

5 Supplemental Figure 4. Oryzalin Depolymerizes Microtubules in Uninduced Control BY-2. The spindle (A) and phragmoplast (B) microtubules were depolymerized in uninduced control BY-2 cells treated with oryzalin. Scale bar = 5 μm. 5

6 Supplemental Figure 5. AFH14-GFP Localization is Irregular or Dispersed in BY-2 Cells Treated with Oryzalin. AFH14-GFP-overexpressing BY-2 cells were treated with oryzalin, causing depolymerization of spindle and phragmoplast microtubules. Confocal microscopy revealed that the AFH14-GFP signal became irregular (A) or dispersed (B) as a result of oryzalin treatment. Scale bar = 5 μm. 6

7 Supplemental Figure 6. Overexpression of AFH14-GFP Increases the Stability of Mitotic Microfilaments. AFH14-GFP-overexpressing BY-2 cells (OX) and control mock-induced cells were treated with 200 nm LatB for 50 min. (A) Microfilaments remained partially intact in OX cells. (B) Microfilaments were deploymerized in control cells. Scale bar = 5 μm. (C) The number of mitotic cells with depolymerized microfilaments (MF) was analyzed in OX and control cells. OX cells exhibited a significantly higher number of cells containing polymerized microfilaments compared to control cells (t-test, P < 0.05). Error bars indicate SE (n > 300). Quantification includes results from three independent experiments. 7

8 Supplemental Figure 7. Phragmoplast Microfilaments Co-distribute with Microtubules in uninduced cells. Microfilaments were clearly present in the region of the phragmoplast microtubules in uninduced control Arabidopsis suspension culture cells. Scale bar = 5 μm. 8

9 Supplemental Figure 8. Analysis of the AFH14 Expression Pattern in Arabidopsis Tissues and Organs. The AFH14 expression pattern in Arabidopsis was analyzed by assessing GUS activity in the tissues and organs of transgenic Arabidopsis harboring an AFH14 promoter:gus gene fusion construct. AFH14 was highly expressed in the (A) shoot apex, (B) leaf primordial and guard cells, (C) trichome, (D) primary root, lateral root, and root hair, with the exception of the root tip, (E) whole floral buds, and (F) meiotic-stage floral buds. (G) Wildtype floral buds are shown as a control. (A-D) Scale bar = 20 μm; (E-G) Scale bar = 1 mm. 9

10 Supplemental Figure 9. Schematic Showing the AFH14 T-DNA Insertion Locus. (A) T-DNA insertion site in the AFH14 gene. The AFH14 gene upstream region is represented by a gray line, and exons and introns are represented by black boxes and lines, respectively. The 5 - and 3 -UTR regions are boxed in gray. (B) Mutants were identified by PCR using appropriate primers (LP, RP). Lanes 1 and 3 correspond to the afh14-1 and afh14-2 mutants, and lanes 2 and 4 correspond to WT plants. (C) RT-PCR using gene-specific primers indicated that no wildtype AFH14 transcripts were detectable in the afh14-1 (Lane 1) and afh14-2 (Lane 3) lines. Lanes 2 and 4 show results from WT plants. 10

11 Supplemental Figure 10. Microspore Formation is Defective in afh14-2 Arabidopsis Plants. (A) Normal tetrad from a WT anther. Arrow indicates the swollen domain. (B-D) A representative dyad (B), triad (C) and polyad (D) from the afh14-2 line. (E) Irregular tetrahedral arrangement of afh14-2 microspores. Scale bar = 5 μm. 11

12 Supplemental Figure 11. Microtubule Array Arrangement is Defective in afh14-2 Plants. Tubulin immunolocalization was analyzed in afh14-2 male meiocytes. (A) In metaphase I, the spindle was abnormal in afh14-2 male meiocytes. (B) In telophase I, the RMSs display a skewed configuration in afh14-2 plants. (C) In metaphase II, the spindles in afh14-2 plants were oriented in a parallel arrangement. (D) In advanced cytokinesis, the phragmoplast microtubules were not clearly present in the afh14-2 mutant. Scale bar = 5 μm. 12

13 Supplemental Figure 12. The FH1FH2 Recombinant Protein Nucleates Microfilaments in vitro. Globular actin (G-actin) was incubated with varying concentrations of FH1FH2 for 5 min, followed by centrifugation at 20,0000 g for 60 min. The amount of actin present in the supernatant (S) and pellet (P) was analyzed by SDS-PAGE. The presence of actin in the pellet in FH1FH2-treated samples indicated that FH1FH2 can nucleate actin polymerization to form microfilaments. Results are representative of three independent experiments. The gel was stained with Coomassie Blue. 13

14 Supplemental Figure 13. Microtubule and Microfilament Organization in the Presence of FH1FH2. Microtubules (A-F, red) or microfilaments (G-L, green) were incubated with active FH1FH2 or heat-denatured FH1FH2. White lines and numbers indicated the diameter of 14

15 the filaments or filament bundles. (A) Individual taxol-stabilized microtubules were incubated with heat-denatured FH1FH2. (B) Addition of active FH1FH2 resulted in bundle formation. (C) Staining using anti-afh14 antibodies revealed the presence of dot-like structures along microtubule bundles. (D, E) Transmission electron microscopy (TEM) analysis of the reactions described in (A) and (B), respectively, confirmed results from immunofluorescence microscopy. (F) Addition of 200 mm NaCl to (B) resulted in dissociation of microtubule bundles. (G) Individual microfilaments were incubated with heat-denatured FH1FH2. (H) Addition of active FH1FH2 resulted in bundle formation. (I) Staining using anti-afh14 antibodies revealed the presence of dot-like structures along microfilament bundles. (J, K) TEM analysis of the reactions described in (G) and (H), respectively, confirmed results from immunofluorescence microscopy. (L) Addition of 200 mm NaCl to (H) resulted in dissociation of microfilament bundles. Scale bar = 5 μm for fluorescence microscopy images, and scale bar = 50 nm for TEM images. 15

16 Supplemental Figure 14. FH1FH2 Inhibits Cold-induced Disassembly of Microtubules in vitro. solutions containing microtubules and FH1FH2 were incubated at 4ºC, and microtubule polymerization was analyzed by confocal microscopy. (A, B) In the presence of heat-denatured FH1FH2, individual microtubules present prior to cold treatment (A) were fully disassembled after incubation at 4ºC (B). (C, D) In the presence of active FH1FH2, the majority of the microtubule bundles present prior to cold treatment (C) persisted after incubation at 4ºC (D) for 30 min or 2 h. Scale bar = 5 μm. 16

17 Supplemental Figure 15. The Thickness of Filaments and Filament Bundles. The thickness of the filaments and filament bundles corresponding to the result of negative stainning electron microscopy were measured. Microtubule (MT), microfilament (MF), microtubule bundles (MTB), microfilament bundles (MFB) and the mixed microtubule and microfilament bundles (MT-MF) after heat-denatured FH1FH2 (dfh1fh2) or active FH1FH2 (afh1fh2) incubation. The active FH1FH2 bundled the filaments, however, the heat-denatured FH1FH2 did not bundled them. Error bars indicate SE (n > 20). 17

18 Supplemental Figure 16. Microtubule and Microfilament Organization in the Presence of the FH2 Recombinant Protein. Microtubules (red) or microfilaments (green) were incubated with (1 μm) active FH2 or heat-denatured FH2. (A) Individual taxol-stabilized microtubules were incubated with heat-denatured FH2. (B) Addition of active FH2 resulted in bundle formation. (C) Staining using anti-afh14 antibodies revealed the presence of dot-like structures along microtubule bundles. (D) Addition of 400 mm NaCl to (B) resulted in dissociation of microtubule bundles. (E) Individual microfilaments were incubated with heat-denatured FH1FH2. (F) Addition of active FH1FH2 resulted in bundle formation. (G) Staining using anti-afh14 antibodies revealed the presence of dot-like structures along microfilament bundles. (H) Addition of 400 mm NaCl to (F) resulted in dissociation of microfilament bundles. (I) FH2 was added to reaction mixtures of microtubules and microfilaments, the two types of bundles co-localized. Scale bar = 5 μm. 18

Supplemental Data. Liu et al. (2013). Plant Cell /tpc

Supplemental Data. Liu et al. (2013). Plant Cell /tpc Supplemental Figure 1. The GFP Tag Does Not Disturb the Physiological Functions of WDL3. (A) RT-PCR analysis of WDL3 expression in wild-type, WDL3-GFP, and WDL3 (without the GFP tag) transgenic seedlings.

More information

The Type II Arabidopsis Formin14 Interacts with Microtubules and Microfilaments to Regulate Cell Division W OA

The Type II Arabidopsis Formin14 Interacts with Microtubules and Microfilaments to Regulate Cell Division W OA The Plant Cell, Vol. 22: 2710 2726, August 2010, www.plantcell.org ã 2010 American Society of Plant Biologists The Type II Arabidopsis Formin14 Interacts with Microtubules and Microfilaments to Regulate

More information

Supplemental Figure 1. VLN5 retains conserved residues at both type 1 and type 2 Ca 2+ -binding

Supplemental Figure 1. VLN5 retains conserved residues at both type 1 and type 2 Ca 2+ -binding Supplemental Figure 1. VLN5 retains conserved residues at both type 1 and type 2 Ca 2+ -binding sites in the G1 domain. Multiple sequence alignment was performed with DNAMAN6.0.40. Secondary structural

More information

Supplemental Figure 1 HDA18 has an HDAC domain and therefore has concentration dependent and TSA inhibited histone deacetylase activity.

Supplemental Figure 1 HDA18 has an HDAC domain and therefore has concentration dependent and TSA inhibited histone deacetylase activity. Supplemental Figure 1 HDA18 has an HDAC domain and therefore has concentration dependent and TSA inhibited histone deacetylase activity. (A) Amino acid alignment of HDA5, HDA15 and HDA18. The blue line

More information

Sequence of C-terminal tail regions of myosin heavy chains in class XI of Nicotiana benthamiana (Nb

Sequence of C-terminal tail regions of myosin heavy chains in class XI of Nicotiana benthamiana (Nb Fig. S1 Sequence of C-terminal tail regions of myosin heavy chains in class XI of Nicotiana benthamiana (Nb myosin XI-2, -F and K) and BY-2 cell (Nt 170-kD myosin and Nt 175-kD myosin). Amino acids identical

More information

S156AT168AY175A (AAA) were purified as GST-fusion proteins and incubated with GSTfused

S156AT168AY175A (AAA) were purified as GST-fusion proteins and incubated with GSTfused 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 Supplemental Materials Supplemental Figure S1 (a) Phenotype of the wild type and grik1-2 grik2-1 plants after 8 days in darkness.

More information

Supplemental Data. Cui et al. (2012). Plant Cell /tpc a b c d. Stem UBC32 ACTIN

Supplemental Data. Cui et al. (2012). Plant Cell /tpc a b c d. Stem UBC32 ACTIN A Root Stem Leaf Flower Silique Senescence leaf B a b c d UBC32 ACTIN C * Supplemental Figure 1. Expression Pattern and Protein Sequence of UBC32 Homologues in Yeast, Human, and Arabidopsis. (A) Expression

More information

Supplemental Data. Wu et al. (2). Plant Cell..5/tpc RGLG Hormonal treatment H2O B RGLG µm ABA µm ACC µm GA Time (hours) µm µm MJ µm IA

Supplemental Data. Wu et al. (2). Plant Cell..5/tpc RGLG Hormonal treatment H2O B RGLG µm ABA µm ACC µm GA Time (hours) µm µm MJ µm IA Supplemental Data. Wu et al. (2). Plant Cell..5/tpc..4. A B Supplemental Figure. Immunoblot analysis verifies the expression of the AD-PP2C and BD-RGLG proteins in the Y2H assay. Total proteins were extracted

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION AS-NMD modulates FLM-dependent thermosensory flowering response in Arabidopsis NATURE PLANTS www.nature.com/natureplants 1 Supplementary Figure 1. Genomic sequence of FLM along with the splice sites. Sequencing

More information

Supplemental Figure 1 Human REEP family of proteins can be divided into two distinct subfamilies. Residues (single letter amino acid code) identical

Supplemental Figure 1 Human REEP family of proteins can be divided into two distinct subfamilies. Residues (single letter amino acid code) identical Supplemental Figure Human REEP family of proteins can be divided into two distinct subfamilies. Residues (single letter amino acid code) identical in all six REEPs are highlighted in green. Additional

More information

Supplementary Figure S1. Immunodetection of full-length XA21 and the XA21 C-terminal cleavage product.

Supplementary Figure S1. Immunodetection of full-length XA21 and the XA21 C-terminal cleavage product. Supplementary Information Supplementary Figure S1. Immunodetection of full-length XA21 and the XA21 C-terminal cleavage product. Total protein extracted from Kitaake wild type and rice plants carrying

More information

Supplemental Data. Sethi et al. (2014). Plant Cell /tpc

Supplemental Data. Sethi et al. (2014). Plant Cell /tpc Supplemental Data Supplemental Figure 1. MYC2 Binds to the E-box but not the E1-box of the MPK6 Promoter. (A) E1-box and E-box (wild type) containing MPK6 promoter fragment. The region shown in red denotes

More information

Supplemental Data. Farmer et al. (2010) Plant Cell /tpc

Supplemental Data. Farmer et al. (2010) Plant Cell /tpc Supplemental Figure 1. Amino acid sequence comparison of RAD23 proteins. Identical and similar residues are shown in the black and gray boxes, respectively. Dots denote gaps. The sequence of plant Ub is

More information

Supplementary Figure 1 Collision-induced dissociation (CID) mass spectra of peptides from PPK1, PPK2, PPK3 and PPK4 respectively.

Supplementary Figure 1 Collision-induced dissociation (CID) mass spectra of peptides from PPK1, PPK2, PPK3 and PPK4 respectively. Supplementary Figure 1 lision-induced dissociation (CID) mass spectra of peptides from PPK1, PPK, PPK3 and PPK respectively. % of nuclei with signal / field a 5 c ppif3:gus pppk1:gus 0 35 30 5 0 15 10

More information

Supplemental Data. Benstein et al. (2013). Plant Cell /tpc

Supplemental Data. Benstein et al. (2013). Plant Cell /tpc Supplemental Figure 1. Purification of the heterologously expressed PGDH1, PGDH2 and PGDH3 enzymes by Ni-NTA affinity chromatography. Protein extracts (2 µl) of different fractions (lane 1 = total extract,

More information

Supplementary Figure 1 PZA inhibits root hair formation as well as cell elongation in the maturation zone of eto1-2 roots. (A) The PI staining of the

Supplementary Figure 1 PZA inhibits root hair formation as well as cell elongation in the maturation zone of eto1-2 roots. (A) The PI staining of the Supplementary Figure 1 PZA inhibits root hair formation as well as cell elongation in the maturation zone of eto1-2 roots. (A) The PI staining of the roots of three-day-old etiolated seedlings of Col-0

More information

Supplemental Data. Wu and Xue (2010). Plant Cell /tpc

Supplemental Data. Wu and Xue (2010). Plant Cell /tpc Supplemental Data. Wu and Xue (21). Plant Cell 1.115/tpc.11.75564 A P1-S P1-A P2-S P2-A P3-S P3-A P4-S P4-A B Relative expression Relative expression C 5. 4.5 4. 3.5 3. 2.5 2. 1.5 1..5 5. 4.5 4. 3.5 3.

More information

Supplementary Figure 1. jmj30-2 and jmj32-1 produce null mutants. (a) Schematic drawing of JMJ30 and JMJ32 genome structure showing regions amplified

Supplementary Figure 1. jmj30-2 and jmj32-1 produce null mutants. (a) Schematic drawing of JMJ30 and JMJ32 genome structure showing regions amplified Supplementary Figure 1. jmj30-2 and jmj32-1 produce null mutants. (a) Schematic drawing of JMJ30 and JMJ32 genome structure showing regions amplified by primers used for mrna expression analysis. Gray

More information

WiscDsLox485 ATG < > //----- E1 E2 E3 E4 E bp. Col-0 arr7 ARR7 ACTIN7. s of mrna/ng total RNA (x10 3 ) ARR7.

WiscDsLox485 ATG < > //----- E1 E2 E3 E4 E bp. Col-0 arr7 ARR7 ACTIN7. s of mrna/ng total RNA (x10 3 ) ARR7. A WiscDsLox8 ATG < > -9 +0 > ---------//----- E E E E E UTR +9 UTR +0 > 00bp B S D ol-0 arr7 ol-0 arr7 ARR7 ATIN7 D s of mrna/ng total RNA opie 0. ol-0 (x0 ) arr7 ARR7 Supplemental Fig.. Genotyping and

More information

Supplemental Data. Na Xu et al. (2016). Plant Cell /tpc

Supplemental Data. Na Xu et al. (2016). Plant Cell /tpc Supplemental Figure 1. The weak fluorescence phenotype is not caused by the mutation in At3g60240. (A) A mutation mapped to the gene At3g60240. Map-based cloning strategy was used to map the mutated site

More information

A Repressor Complex Governs the Integration of

A Repressor Complex Governs the Integration of Developmental Cell 15 Supplemental Data A Repressor Complex Governs the Integration of Flowering Signals in Arabidopsis Dan Li, Chang Liu, Lisha Shen, Yang Wu, Hongyan Chen, Masumi Robertson, Chris A.

More information

Supplemental Figure 1. Alignment of the NbGAPC amino acid sequences with their Arabidopsis homologues.

Supplemental Figure 1. Alignment of the NbGAPC amino acid sequences with their Arabidopsis homologues. Supplemental Figure 1. Alignment of the NbGAPC amino acid sequences with their Arabidopsis homologues. Homologs from N. benthamiana (NbGAPC1, NbGAPC2, NbGAPC3), Arabidopsis (AtGAPC1, AT3G04120; AtGAPC2,

More information

Supplemental Data. Guo et al. (2015). Plant Cell /tpc

Supplemental Data. Guo et al. (2015). Plant Cell /tpc Supplemental Figure 1. The Mutant exb1-d Displayed Pleiotropic Phenotypes and Produced Branches in the Axils of Cotyledons. (A) Branches were developed in exb1-d but not in wild-type plants. (B) and (C)

More information

Supplementary Fig 1. The responses of ERF109 to different hormones and stresses. (a to k) The induced expression of ERF109 in 7-day-old Arabidopsis

Supplementary Fig 1. The responses of ERF109 to different hormones and stresses. (a to k) The induced expression of ERF109 in 7-day-old Arabidopsis Supplementary Fig 1. The responses of ERF109 to different hormones and stresses. (a to k) The induced expression of ERF109 in 7-day-old Arabidopsis seedlings expressing ERF109pro-GUS. The GUS staining

More information

indicated numbers of pups at day of life (DOL) 10, or embryonic day (ED) B. Male mice of

indicated numbers of pups at day of life (DOL) 10, or embryonic day (ED) B. Male mice of SUPPLEMENTRY FIGURE LEGENDS Figure S1. USP44 loss leads to chromosome missegregation.. Genotypes obtained from the indicated numbers of pups at day of life (DOL) 10, or embryonic day (ED) 13.5.. Male mice

More information

Supplemental Information. Plk1/Polo Phosphorylates Sas-4 at the Onset. of Mitosis for an Efficient Recruitment

Supplemental Information. Plk1/Polo Phosphorylates Sas-4 at the Onset. of Mitosis for an Efficient Recruitment Cell Reports, Volume 25 Supplemental Information Plk1/Polo Phosphorylates Sas-4 at the Onset of Mitosis for an Efficient Recruitment of Pericentriolar Material to Centrosomes Anand Ramani, Aruljothi Mariappan,

More information

Supplementary data. sienigma. F-Enigma F-EnigmaSM. a-p53

Supplementary data. sienigma. F-Enigma F-EnigmaSM. a-p53 Supplementary data Supplemental Figure 1 A sienigma #2 sienigma sicontrol a-enigma - + ++ - - - - - - + ++ - - - - - - ++ B sienigma F-Enigma F-EnigmaSM a-flag HLK3 cells - - - + ++ + ++ - + - + + - -

More information

- 1 - Supplemental Data

- 1 - Supplemental Data - 1-1 Supplemental Data 2 3 4 5 6 7 8 9 Supplemental Figure S1. Differential expression of AtPIP Genes in DC3000-inoculated plants. Gene expression in leaves was analyzed by real-time RT-PCR and expression

More information

A Nucleus-Encoded Chloroplast Protein YL1 Is Involved in Chloroplast. Development and Efficient Biogenesis of Chloroplast ATP Synthase in Rice

A Nucleus-Encoded Chloroplast Protein YL1 Is Involved in Chloroplast. Development and Efficient Biogenesis of Chloroplast ATP Synthase in Rice A Nucleus-Encoded Chloroplast Protein YL1 Is Involved in Chloroplast Development and Efficient Biogenesis of Chloroplast ATP Synthase in Rice Fei Chen 1,*, Guojun Dong 2,*, Limin Wu 1, Fang Wang 3, Xingzheng

More information

Supplemental Data. Meng et al. (2011). Plant Cell /tpc B73 CML311 CML436. Gaspé Flint

Supplemental Data. Meng et al. (2011). Plant Cell /tpc B73 CML311 CML436. Gaspé Flint Gaspé Flint B73 CML311 CML436 A B C D 10 th leaf 10 th leaf 10 th leaf Supplemental Figure 1. Whole plant images of the four varieties used in this study (A) Extreme early flowering temperate line Gaspé

More information

- PDI5. - Actin A 300-UTR5. PDI5 lines WT. Arabidopsis Chromosome 1. PDI5 (At1g21750) SALK_ SALK_ SALK_015253

- PDI5. - Actin A 300-UTR5. PDI5 lines WT. Arabidopsis Chromosome 1. PDI5 (At1g21750) SALK_ SALK_ SALK_015253 Supplemental Data. Ondzighi et al. (2008). Arabidopsis Protein Disulfide Isomerase-5 Inhibits ysteine Proteases During Trafficking to Vacuoles Prior to Programmed ell Death of the dothelium in Developing

More information

Fig. S1. Molecular phylogenetic analysis of AtHD-ZIP IV family. A phylogenetic tree was constructed using Bayesian analysis with Markov Chain Monte

Fig. S1. Molecular phylogenetic analysis of AtHD-ZIP IV family. A phylogenetic tree was constructed using Bayesian analysis with Markov Chain Monte Fig. S1. Molecular phylogenetic analysis of AtHD-ZIP IV family. A phylogenetic tree was constructed using Bayesian analysis with Markov Chain Monte Carlo algorithm for one million generations to obtain

More information

Sperm cells are passive cargo of the pollen tube in plant fertilization

Sperm cells are passive cargo of the pollen tube in plant fertilization In the format provided by the authors and unedited. SUPPLEMENTARY INFORMATION VOLUME: 3 ARTICLE NUMBER: 17079 Sperm cells are passive cargo of the pollen tube in plant fertilization Jun Zhang 1, Qingpei

More information

Supplemental Data. Seo et al. (2014). Plant Cell /tpc

Supplemental Data. Seo et al. (2014). Plant Cell /tpc Supplemental Figure 1. Protein alignment of ABD1 from other model organisms. The alignment was performed with H. sapiens DCAF8, M. musculus DCAF8 and O. sativa Os10g0544500. The WD40 domains are underlined.

More information

Supplemental data. Zhao et al. (2009). The Wuschel-related homeobox gene WOX11 is required to activate shoot-borne crown root development in rice.

Supplemental data. Zhao et al. (2009). The Wuschel-related homeobox gene WOX11 is required to activate shoot-borne crown root development in rice. Supplemental data. Zhao et al. (2009). The Wuschel-related homeobox gene WOX11 is required to activate shoot-borne crown root development in rice. A B Supplemental Figure 1. Expression of WOX11p-GUS WOX11-GFP

More information

Nature Genetics: doi: /ng.3556 INTEGRATED SUPPLEMENTARY FIGURE TEMPLATE. Supplementary Figure 1

Nature Genetics: doi: /ng.3556 INTEGRATED SUPPLEMENTARY FIGURE TEMPLATE. Supplementary Figure 1 INTEGRATED SUPPLEMENTARY FIGURE TEMPLATE Supplementary Figure 1 REF6 expression in transgenic lines. (a,b) Expression of REF6 in REF6-HA ref6 and REF6ΔZnF-HA ref6 plants detected by RT qpcr (a) and immunoblot

More information

Fig. S1. Endocytosis of extracellular cargo does not depend on dia. (A) To visualize endocytosis, fluorescently labelled wheat germ agglutinin

Fig. S1. Endocytosis of extracellular cargo does not depend on dia. (A) To visualize endocytosis, fluorescently labelled wheat germ agglutinin Fig. S1. Endocytosis of extracellular cargo does not depend on dia. (A) To visualize endocytosis, fluorescently labelled wheat germ agglutinin (WGA-Alexa555) was injected into the extracellular perivitteline

More information

Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table.

Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table. Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table. Name Sequence (5-3 ) Application Flag-u ggactacaaggacgacgatgac Shared upstream primer for all the amplifications of

More information

Supplemental Information

Supplemental Information Supplemental Information Supplemental Figure 1. The Heterologous Yeast System for Screening of Arabidopsis JA Transporters. (A) Exogenous JA inhibited yeast cell growth. Yeast cells were diluted to various

More information

T H E J O U R N A L O F C E L L B I O L O G Y

T H E J O U R N A L O F C E L L B I O L O G Y T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Bays et al., http://www.jcb.org/cgi/content/full/jcb.201309092/dc1 Figure S1. Specificity of the phospho-y822 antibody. (A) Total cell

More information

Supplementary Figures 1-12

Supplementary Figures 1-12 Supplementary Figures 1-12 Supplementary Figure 1. The specificity of anti-abi1 antibody. Total Proteins extracted from the wild type seedlings or abi1-3 null mutant seedlings were used for immunoblotting

More information

Supplemental Data. Zhou et al. (2016). Plant Cell /tpc

Supplemental Data. Zhou et al. (2016). Plant Cell /tpc Supplemental Figure 1. Confirmation of mutant mapping results. (A) Complementation assay with stably transformed genomic fragments (ComN-N) (2 kb upstream of TSS and 1.5 kb downstream of TES) and CaMV

More information

Supplemental Figure 1.

Supplemental Figure 1. Supplemental Data. Charron et al. Dynamic landscapes of four histone modifications during de-etiolation in Arabidopsis. Plant Cell (2009). 10.1105/tpc.109.066845 Supplemental Figure 1. Immunodetection

More information

PHT1;2-CFP YFP-PHF + PHT1;2-CFP YFP-PHF

PHT1;2-CFP YFP-PHF + PHT1;2-CFP YFP-PHF YFP-PHF1 CFP-PHT1;2 PHT1;2-CFP YFP-PHF + PHT1;2-CFP YFP-PHF + CFP-PHT1;2 Negative control!-gfp Supplemental Figure 1: PHT1;2 accumulation is PHF1 dependent. Immunoblot analysis on total protein extract

More information

Figure S1. Verification of ihog Mutation by Protein Immunoblotting Figure S2. Verification of ihog and boi

Figure S1. Verification of ihog Mutation by Protein Immunoblotting Figure S2. Verification of ihog and boi Figure S1. Verification of ihog Mutation by Protein Immunoblotting Extracts from S2R+ cells, embryos, and adults were analyzed by immunoprecipitation and immunoblotting with anti-ihog antibody. The Ihog

More information

Fig. S1. Effect of p120-catenin overexpression on the interaction of SCUBE2 with E-cadherin. The expression plasmid encoding FLAG.

Fig. S1. Effect of p120-catenin overexpression on the interaction of SCUBE2 with E-cadherin. The expression plasmid encoding FLAG. Fig. S1. Effect of p120-catenin overexpression on the interaction of SCUBE2 with E-cadherin. The expression plasmid encoding FLAG.SCUBE2, E-cadherin.Myc, or HA.p120-catenin was transfected in a combination

More information

Supplemental Data. Borg et al. Plant Cell (2014) /tpc

Supplemental Data. Borg et al. Plant Cell (2014) /tpc Supplementary Figure 1 - Alignment of selected angiosperm DAZ1 and DAZ2 homologs Multiple sequence alignment of selected DAZ1 and DAZ2 homologs. A consensus sequence built using default parameters is shown

More information

Supplemental Figure legends Figure S1. (A) (B) (C) (D) Figure S2. Figure S3. (A-E) Figure S4. Figure S5. (A, C, E, G, I) (B, D, F, H, Figure S6.

Supplemental Figure legends Figure S1. (A) (B) (C) (D) Figure S2. Figure S3. (A-E) Figure S4. Figure S5. (A, C, E, G, I) (B, D, F, H, Figure S6. Supplemental Figure legends Figure S1. Map-based cloning and complementation testing for ZOP1. (A) ZOP1 was mapped to a ~273-kb interval on Chromosome 1. In the interval, a single-nucleotide G to A substitution

More information

Fig. S1. TPL and TPL N176H protein interactions. (A) Semi-in vivo pull-down assays using recombinant GST N-TPL and GST N-TPL N176H fusions and

Fig. S1. TPL and TPL N176H protein interactions. (A) Semi-in vivo pull-down assays using recombinant GST N-TPL and GST N-TPL N176H fusions and Fig. S1. TPL and TPL N176H protein interactions. (A) Semi-in vivo pull-down assays using recombinant GST N-TPL and GST N-TPL N176H fusions and transgenic Arabidopsis TPL-HA lysates. Immunoblotting of input

More information

Supplementary Methods

Supplementary Methods Supplementary Methods Reverse transcribed Quantitative PCR. Total RNA was isolated from bone marrow derived macrophages using RNeasy Mini Kit (Qiagen), DNase-treated (Promega RQ1), and reverse transcribed

More information

JCB. Supplemental material THE JOURNAL OF CELL BIOLOGY. Hong et al.,

JCB. Supplemental material THE JOURNAL OF CELL BIOLOGY. Hong et al., Supplemental material JCB Hong et al., http://www.jcb.org/cgi/content/full/jcb.201412127/dc1 THE JOURNAL OF CELL BIOLOGY Figure S1. Analysis of purified proteins by SDS-PAGE and pull-down assays. (A) Coomassie-stained

More information

SAS6-like protein in Plasmodium indicates that conoid-associated apical complex proteins persist in invasive stages within the mosquito vector

SAS6-like protein in Plasmodium indicates that conoid-associated apical complex proteins persist in invasive stages within the mosquito vector SAS6-like protein in Plasmodium indicates that conoid-associated apical complex proteins persist in invasive stages within the mosquito vector Richard J. Wall 1,#, Magali Roques 1,+, Nicholas J. Katris

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature12119 SUPPLEMENTARY FIGURES AND LEGENDS pre-let-7a- 1 +14U pre-let-7a- 1 Ddx3x Dhx30 Dis3l2 Elavl1 Ggt5 Hnrnph 2 Osbpl5 Puf60 Rnpc3 Rpl7 Sf3b3 Sf3b4 Tia1 Triobp U2af1 U2af2 1 6 2 4 3

More information

Supplementary information

Supplementary information Supplementary information Supplementary figures Figure S1 Level of mycdet1 protein in DET1 OE-1, OE-2 and OE-3 transgenic lines. Total protein extract from wild type Col0, det1-1 mutant and DET1 OE lines

More information

Supplemental Figure S1. Nucleotide and deduced amino acid sequences of pepper CaHSP70a (Capsicum annuum heat shock protein 70a) cdna.

Supplemental Figure S1. Nucleotide and deduced amino acid sequences of pepper CaHSP70a (Capsicum annuum heat shock protein 70a) cdna. Supplemental Figure S1. Nucleotide and deduced amino acid sequences of pepper (Capsicum annuum heat shock protein 70a) cdna. Translation initiation codon is shown in bold typeface; termination codon is

More information

GTTCGGGTTCC TTTTGAGCAG

GTTCGGGTTCC TTTTGAGCAG Supplementary Figures Splice variants of the SIP1 transcripts play a role in nodule organogenesis in Lotus japonicus. Wang C, Zhu H, Jin L, Chen T, Wang L, Kang H, Hong Z, Zhang Z. 5 UTR CDS 3 UTR TCTCAACCATCCTTTGTCTGCTTCCGCCGCATGGGTGAGGTCATTTTGTCTAGATGACGTGCAATTTACAATGA

More information

Three major types of cytoskeleton

Three major types of cytoskeleton The Cytoskeleton Organizes and stabilizes cells Pulls chromosomes apart Drives intracellular traffic Supports plasma membrane and nuclear envelope Enables cellular movement Guides growth of the plant cell

More information

Supplemental Data. Li et al. (2015). Plant Cell /tpc

Supplemental Data. Li et al. (2015). Plant Cell /tpc Supplemental Data Supplemental Figure 1: Characterization of asr3 T-DNA knockout lines and complementation transgenic lines. (A) The scheme of At2G33550 (ASR3) with gray boxes indicating exons and dash

More information

Supplementary Information

Supplementary Information Supplementary Information MED18 interaction with distinct transcription factors regulates plant immunity, flowering time and responses to hormones Supplementary Figure 1. Diagram showing T-DNA insertion

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature11070 Supplementary Figure 1 Purification of FLAG-tagged proteins. a, Purification of FLAG-RNF12 by FLAG-affinity from nuclear extracts of wild-type (WT) and two FLAG- RNF12 transgenic

More information

AD BD TOC1. Supplementary Figure 1: Yeast two-hybrid assays showing the interaction between

AD BD TOC1. Supplementary Figure 1: Yeast two-hybrid assays showing the interaction between AD X BD TOC1 AD BD X PIFΔAD PIF TOC1 TOC1 PIFΔAD PIF N TOC1 TOC1 C1 PIFΔAD PIF C1 TOC1 TOC1 C PIFΔAD PIF C TOC1 Supplementary Figure 1: Yeast two-hybrid assays showing the interaction between PIF and TOC1

More information

PIE1 ARP6 SWC6 KU70 ARP6 PIE1. HSA SNF2_N HELICc SANT. pie1-3 A1,A2 K1,K2 K1,K3 K3,LB2 A3, A4 A3,LB1 A1,A2 K1,K2 K1,K3. swc6-1 A3,A4.

PIE1 ARP6 SWC6 KU70 ARP6 PIE1. HSA SNF2_N HELICc SANT. pie1-3 A1,A2 K1,K2 K1,K3 K3,LB2 A3, A4 A3,LB1 A1,A2 K1,K2 K1,K3. swc6-1 A3,A4. A B N-terminal SWC2 H2A.Z SWC6 ARP6 PIE1 HSA SNF2_N HELICc SANT C pie1-3 D PIE1 ARP6 5 Kb A1 200 bp A3 A2 LB1 arp6-3 A4 E A1,A2 A3, A4 A3,LB1 K1,K2 K1,K3 K3,LB2 SWC6 swc6-1 A1,A2 A3,A4 K1,K2 K1,K3 100

More information

Supplemental Data. Lee et al. Plant Cell. (2010) /tpc Supplemental Figure 1. Protein and Gene Structures of DWA1 and DWA2.

Supplemental Data. Lee et al. Plant Cell. (2010) /tpc Supplemental Figure 1. Protein and Gene Structures of DWA1 and DWA2. Supplemental Figure 1. Protein and Gene Structures of DWA1 and DWA2. (A) Protein structures of DWA1 and DWA2. WD40 region was determined based on the NCBI conserved domain databases (B, C) Schematic representation

More information

3 -end. Sau3A. 3 -end TAA TAA. ~9.1kb SalI TAA. ~12.6kb. HindШ ATG 5,860bp TAA. ~12.7kb

3 -end. Sau3A. 3 -end TAA TAA. ~9.1kb SalI TAA. ~12.6kb. HindШ ATG 5,860bp TAA. ~12.7kb Supplemental Data. Chen et al. (2008). Badh2, encoding betaine aldehyde dehydrogenase, inhibits the biosynthesis of 2-acetyl-1-pyrroline, a major component in rice fragrance. A pcam-cah/cah Sau3A Promoter

More information

Supplemental Data. Furlan et al. Plant Cell (2017) /tpc

Supplemental Data. Furlan et al. Plant Cell (2017) /tpc Supplemental Data. Furlan et al. Plant Cell (0) 0.0/tpc..00. Supplemental Data. Furlan et al. Plant Cell (0) 0.0/tpc..00. Supplemental Data. Furlan et al. Plant Cell (0) 0.0/tpc..00. Supplemental Figure.

More information

Supplemental Materials

Supplemental Materials Supplemental Materials Flores-Pérez et al., Supplemental Materials, page 1 of 5 Supplemental Figure S1. Pull-down and BiFC controls, and quantitative analyses associated with the BiFC studies. (A) Controls

More information

Supporting Information

Supporting Information Supporting Information Deng et al. 10.1073/pnas.1102117108 Fig. S1. Predicted structure of Arabidopsis bzip60 RNA. Lowest free energy form (ΔG = 309.72 (initially 343.10) of bzip60 mrna folded by M-Fold

More information

Supplemental Data. Aung et al. (2011). Plant Cell /tpc

Supplemental Data. Aung et al. (2011). Plant Cell /tpc 35S pro:pmd1-yfp 10 µm Supplemental Figure 1. -terminal YFP fusion of PMD1 (PMD1-YFP, in green) is localized to the cytosol. grobacterium cells harboring 35S pro :PMD1-YFP were infiltrated into tobacco

More information

Supplemental Figure 1

Supplemental Figure 1 Supplemental Figure 1 A gta2-1 gta2-2 1kb AT4G08350 B Col-0 gta2-1 LP+RP+LBb1.3 C Col-0 gta2-2 LP+RP+LB1 D Col-0 gta2-2 gta2-1 GTA2 TUBLIN E Col0 gta2-1 gta2-2 Supplemental Figure 1. Phenotypic analysis

More information

Supplementary Figure 1

Supplementary Figure 1 Supplementary Figure 1 Supplementary Fig. 1 shrna mediated knockdown of ZRSR2 in K562 and 293T cells. (a) ZRSR2 transcript levels in stably transduced K562 cells were determined using qrt-pcr. GAPDH was

More information

A novel tool for monitoring endogenous alpha-synuclein transcription by NanoLuciferase

A novel tool for monitoring endogenous alpha-synuclein transcription by NanoLuciferase A novel tool for monitoring endogenous alpha-synuclein transcription by NanoLuciferase tag insertion at the 3 end using CRISPR-Cas9 genome editing technique Sambuddha Basu 1, 3, Levi Adams 1, 3, Subhrangshu

More information

University of Dundee. Published in: Scientific Reports. DOI: /srep Publication date: 2016

University of Dundee. Published in: Scientific Reports. DOI: /srep Publication date: 2016 University of Dundee SAS6-like protein in Plasmodium indicates that conoid-associated apical complex proteins persist in invasive stages within the mosquito vector Wall, Richard J.; Roques, Magali; Katris,

More information

The Arabidopsis Transcription Factor BES1 Is a Direct Substrate of MPK6 and Regulates Immunity

The Arabidopsis Transcription Factor BES1 Is a Direct Substrate of MPK6 and Regulates Immunity Supplemental Data The Arabidopsis Transcription Factor BES1 Is a Direct Substrate of MPK6 and Regulates Immunity Authors: Sining Kang, Fan Yang, Lin Li, Huamin Chen, She Chen and Jie Zhang The following

More information

Supplementary Figure 1

Supplementary Figure 1 Supplementary Figure 1 Product purity of cytosine base editing for the wheat genomic loci tested. Product distributions and indels frequencies at four representative wheat genomic DNA sites in wheat protoplasts

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Gene replacements and insertions in rice by intron targeting using CRISPR Cas9 Table of Contents Supplementary Figure 1. sgrna-induced targeted mutations in the OsEPSPS gene in rice protoplasts. Supplementary

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION R2A MASNSEKNPLL-SDEKPKSTEENKSS-KPESASGSSTSSAMP---GLNFNAFDFSNMASIL 56 R2B MASSSEKTPLIPSDEKNDTKEESKSTTKPESGSGAPPSPS-PTDPGLDFNAFDFSGMAGIL 60 R2A NDPSIREMAEQIAKDPAFNQLAEQLQRSIPNAGQEGGFPNFDPQQYVNTMQQVMHNPEFK

More information

Supplemental Information

Supplemental Information Supplemental Information ATP-dependent unwinding of U4/U6 snrnas by the Brr2 helicase requires the C-terminus of Prp8 Corina Maeder 1,3, Alan K. Kutach 1,2,3, and Christine Guthrie 1 1 Department of Biochemistry

More information

Alternative Cleavage and Polyadenylation of RNA

Alternative Cleavage and Polyadenylation of RNA Developmental Cell 18 Supplemental Information The Spen Family Protein FPA Controls Alternative Cleavage and Polyadenylation of RNA Csaba Hornyik, Lionel C. Terzi, and Gordon G. Simpson Figure S1, related

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Ca 2+ /calmodulin Regulates Salicylic Acid-mediated Plant Immunity Liqun Du, Gul S. Ali, Kayla A. Simons, Jingguo Hou, Tianbao Yang, A.S.N. Reddy and B. W. Poovaiah * *To whom correspondence should be

More information

Supplementary Figure 1. Nature Structural & Molecular Biology: doi: /nsmb.3494

Supplementary Figure 1. Nature Structural & Molecular Biology: doi: /nsmb.3494 Supplementary Figure 1 Pol structure-function analysis (a) Inactivating polymerase and helicase mutations do not alter the stability of Pol. Flag epitopes were introduced using CRISPR/Cas9 gene targeting

More information

Supplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling

Supplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling Supplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling Glendining KA 1, Markie D 2, Gardner RJM 4, Franz EA 3, Robertson SP 4, Jasoni CL 1 Supplementary

More information

Supplemental Fig. 1. Transient expression of dynamic reporters of DNA methylation (DYNAMETs) in plants. (A) Schematic representation of potential

Supplemental Fig. 1. Transient expression of dynamic reporters of DNA methylation (DYNAMETs) in plants. (A) Schematic representation of potential Supplemental Fig. 1. Transient expression of dynamic reporters of DNA methylation (DYNAMETs) in plants. (A) Schematic representation of potential dynamic reporter of DNA methylation (DYNAMET). A DYNAMET

More information

Confocal immunofluorescence microscopy

Confocal immunofluorescence microscopy Confocal immunofluorescence microscopy HL-6 and cells were cultured and cytospun onto glass slides. The cells were double immunofluorescence stained for Mt NPM1 and fibrillarin (nucleolar marker). Briefly,

More information

Supplemental Data. Hachez et al. Plant Cell (2014) /tpc Suppl. Figure 1A

Supplemental Data. Hachez et al. Plant Cell (2014) /tpc Suppl. Figure 1A Suppl. Figure 1A Suppl. Figure 1B Supplemental Figure 1: Results of the commercial screening of interactants using split ubiquitin technique. (A) Isolated preys (192) using the bait construct pbt3-n- as

More information

A subclass of HSP70s regulate development and abiotic stress responses in Arabidopsis thaliana

A subclass of HSP70s regulate development and abiotic stress responses in Arabidopsis thaliana 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 Journal of Plant Research A subclass of HSP70s regulate development and abiotic stress responses in Arabidopsis thaliana Linna Leng 1 Qianqian Liang

More information

Fig. S1. Clustering analysis of expression array and ChIP-PCR assay in the ARF3 locus. (A) Typical examples of the transgenic plants used for

Fig. S1. Clustering analysis of expression array and ChIP-PCR assay in the ARF3 locus. (A) Typical examples of the transgenic plants used for Fig. S1. Clustering analysis of expression array and ChIP-PCR assay in the ARF3 locus. (A) Typical examples of the transgenic plants used for ChIP-chip and ChIP-PCR assays. The presence of pas1:t7:as1

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb3363 Supplementary Figure 1 Several WNTs bind to the extracellular domains of PKD1. (a) HEK293T cells were co-transfected with indicated plasmids. Flag-tagged proteins were immunoprecipiated

More information

Revised: RG-RV2 by Fukuhara et al.

Revised: RG-RV2 by Fukuhara et al. Supplemental Figure 1 The generation of Spns2 conditional knockout mice. (A) Schematic representation of the wild type Spns2 locus (Spns2 + ), the targeted allele, the floxed allele (Spns2 f ) and the

More information

Hossain_Supplemental Figure 1

Hossain_Supplemental Figure 1 Hossain_Supplemental Figure 1 GFP-PACT GFP-PACT Motif I GFP-PACT Motif II A. MG132 (1µM) GFP Tubulin GFP-PACT Pericentrin GFP-PACT GFP-PACT Pericentrin Fig. S1. Expression and localization of Orc1 PACT

More information

A Domain Swapping Study of Nano-Capsule Proteins. Rongli Fan, Aimee L. Boyle, Vee Vee Cheong, See Liang Ng, Brendan P. Orner*

A Domain Swapping Study of Nano-Capsule Proteins. Rongli Fan, Aimee L. Boyle, Vee Vee Cheong, See Liang Ng, Brendan P. Orner* A Domain Swapping Study of Nano-Capsule Proteins Rongli Fan, Aimee L. Boyle, Vee Vee Cheong, See Liang Ng, Brendan P. Orner* Figure S1. Amino acid sequences of proteins used in this study. Grey shading

More information

Construction of plant complementation vector and generation of transgenic plants

Construction of plant complementation vector and generation of transgenic plants MATERIAL S AND METHODS Plant materials and growth conditions Arabidopsis ecotype Columbia (Col0) was used for this study. SALK_072009, SALK_076309, and SALK_027645 were obtained from the Arabidopsis Biological

More information

Supplemental Figure 1. Immunoblot analysis of wild-type and mutant forms of JAZ3

Supplemental Figure 1. Immunoblot analysis of wild-type and mutant forms of JAZ3 Supplemental Data. Chung and Howe (2009). A Critical Role for the TIFY Motif in Repression of Jasmonate Signaling by a Stabilized Splice Variant of the JASMONATE ZIM-domain protein JAZ10 in Arabidopsis.

More information

Supplementary Figure 1. Espn-1 knockout characterization. (a) The predicted recombinant Espn-1 -/- allele was detected by PCR of the left (5 )

Supplementary Figure 1. Espn-1 knockout characterization. (a) The predicted recombinant Espn-1 -/- allele was detected by PCR of the left (5 ) Supplementary Figure 1. Espn-1 knockout characterization. (a) The predicted recombinant Espn-1 -/- allele was detected by PCR of the left (5 ) homologous recombination arm (left) and of the right (3 )

More information

7.012 Problem Set 5. Question 1

7.012 Problem Set 5. Question 1 Name Section 7.012 Problem Set 5 Question 1 While studying the problem of infertility, you attempt to isolate a hypothetical rabbit gene that accounts for the prolific reproduction of rabbits. After much

More information

Jung-Nam Cho, Jee-Youn Ryu, Young-Min Jeong, Jihye Park, Ji-Joon Song, Richard M. Amasino, Bosl Noh, and Yoo-Sun Noh

Jung-Nam Cho, Jee-Youn Ryu, Young-Min Jeong, Jihye Park, Ji-Joon Song, Richard M. Amasino, Bosl Noh, and Yoo-Sun Noh Developmental Cell, Volume 22 Supplemental Information Control of Seed Germination by Light-Induced Histone Arginine Demethylation Activity Jung-Nam Cho, Jee-Youn Ryu, Young-Min Jeong, Jihye Park, Ji-Joon

More information

CHAPTER 4 Cloning, expression, purification and preparation of site-directed mutants of NDUFS3 and NDUFS7

CHAPTER 4 Cloning, expression, purification and preparation of site-directed mutants of NDUFS3 and NDUFS7 CHAPTER 4 Cloning, expression, purification and preparation of site-directed mutants of NDUFS3 and NDUFS7 subunits of human mitochondrial Complex-I Q module N DUFS2, 3, 7 and 8 form the core subunits of

More information

Supplementary Information. A novel human endogenous retroviral protein inhibits cell-cell fusion. Supplementary Figures:

Supplementary Information. A novel human endogenous retroviral protein inhibits cell-cell fusion. Supplementary Figures: Supplementary Information A novel human endogenous retroviral protein inhibits cell-cell fusion Jun Sugimoto, Makiko Sugimoto, Helene Bernstein, Yoshihiro Jinno and Danny J. Schust Supplementary Figures:

More information

Cell proliferation was measured with Cell Counting Kit-8 (Dojindo Laboratories, Kumamoto, Japan).

Cell proliferation was measured with Cell Counting Kit-8 (Dojindo Laboratories, Kumamoto, Japan). 1 2 3 4 5 6 7 8 Supplemental Materials and Methods Cell proliferation assay Cell proliferation was measured with Cell Counting Kit-8 (Dojindo Laboratories, Kumamoto, Japan). GCs were plated at 96-well

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION Dynamic Phosphorylation of HP1 Regulates Mitotic Progression in Human Cells Supplementary Figures Supplementary Figure 1. NDR1 interacts with HP1. (a) Immunoprecipitation using

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI:.38/ncb327 a b Sequence coverage (%) 4 3 2 IP: -GFP isoform IP: GFP IP: -GFP IP: GFP Sequence coverage (%) 4 3 2 IP: -GFP IP: GFP 33 52 58 isoform 2 33 49 47 IP: Control IP: Peptide Sequence Start

More information