Supplemental Data. Meng et al. (2011). Plant Cell /tpc B73 CML311 CML436. Gaspé Flint
|
|
|
- Clyde Dawson
- 5 years ago
- Views:
Transcription
1 Gaspé Flint B73 CML311 CML436 A B C D 10 th leaf 10 th leaf 10 th leaf Supplemental Figure 1. Whole plant images of the four varieties used in this study (A) Extreme early flowering temperate line Gaspé Flint produces 6-8 leaves under SDs or LDs. (B) Temperate B73 inbred line produces leaves under SDs or LDs. (C) Photoperiod-sensitive tropical line CML311 produces leaves under LDs and leaves under SDs. (D) Photoperiod-sensitive tropical line CML436 produces leaves under LDs and leaves under SDs. Images of the plants grown in the summer in Iowa, USA (latitude 42 N)
2 3d SD V2 V3 V4 V4 V4 V5 V5 CML311, 3d SD 5d SD V2 V3 V4 V4 V4 V5 V6 V8 CML311, 5d SD V3 V4 3d SD V4 V5 V5 V6 V7 V8 CML436, 3d SD CML436, 5d SD V3 V4 V4 5d SD V5 V5 V6 V7 V8 V9 V10 V11 Supplemental Figure 2. Shoot apices of tropical varieties after three and five SDs treatments. Shoot apices of tropical lines CML311 and CML436 exposed for 3 or 5 short days. Plants were grown under continuous LDs until V5, transferred to SDs for 3 or 5 days and then returned to LDs. Under continuous SD treatment, CML311 and CML436 transition are around stage V4-V5. Under continuous LD treatment, CML311 starts to transition around V7 and CML436 around V10. Arrows indicate the growth stage of the floral transition. Long days were 16 h of light and 8 h of dark. Short days were of 8 h of light and 16 h of dark.
3 A SD Gigz1 LD SD Conz1 LD R elative expression R elative expression R elative expression Gaspé B73 CML436 R elative expression B LD LD CML Supplemental Figure 3. Diurnal expression of Gigz1 and Conz1 in leaf blades of plants grown under either SDs or LDs. (A) Diurnal expression of Gigz1 and Conz1 prior the floral transition under SDs and in Gaspé and B73 under LDs and during vegetative stage growth of CML436 under LDs. (B) Expression patterns of Gigz1 and Conz1 in CML436 during the floral transition under LDs.
4 A B Supplemental Figure 4. ZCN8 diurnal expression in the tropical line CML436 under LDs. (A) ZCN8 diurnal expression in CML436 mature leaf at vegetative growth stages under LDs at an expanded scale from Figure 3. (B) ZCN8 diurnal expression in the CML436 mature leaf during the floral transition under natural LD conditions.
5 WT dlf1-n2461a id1-m DAS ZCN7 ZCN8 ZCN12 ZCN14 ZCN15 ZCN18 ZCN26 Actin Supplemental Figure 5. FT-like ZCN genes are not expressed in the immature leaf of WT and late flowering mutants. The numbers above the gel indicate the days after sowing (DAS). The red arrow shows the stage of the floral transition in the two late flowering mutants. Expression was not detected for any of the genes tested in immature leaf of WT or late flowering mutants. RT-PCR products were detected by ethidium bromide staining in agarose gels.
6 A WT dlf1-n2461a V3 V4 V5 V6 V7 V8 V3 V7 V8 V9 ZCN14 Actin B WT id1-m1 V3 V4 V5 V6 V7 V8 V9 V4 V6 V8 V10 V12 V14 V16 V18 V19 ZCN14 Actin Supplemental Figure 6. ZCN14 expression patterns in shoot apices of WT and late flowering mutants. WT, dlf1 (A) and id1 (B) are the B73 background. The WT floral transition occurred around V4, and dlf1 transitioned around V6 and id1 around V11. The red arrow indicates the stage of the floral transition. ZCN14 mrna was detected by RT-PCR in the shoot apices after the floral transition. PCR products were detected by ethidium bromide staining in agarose gels.
7 A B C D Supplemental Figure 7. Negative controls for RNA in situ hybridization. In situ hybridization of ZCN7 intron antisense (A) and sense (B) probes to transverse sections of mature B73 leaf. Sense controls of ZCN8 (C) and ZCN26 (D). Bars=100 μm
8 A D B C E F Supplemental Figure 8. ZCN8 RNA in situ hybridization to the leaf tip of B73 at stages V4 and V6. (A), (B) and (C) Hybridization signals of ZCN8 antisense DIG-labeled probe to transverse sections of B73 mature leaf blades at stage V4 prior the floral transition. (D), (E) and (F) Hybridization signals of ZCN8 antisense DIG-labeled probe to transverse sections of B73 mature leaf blades at stage V6, after the floral transition. (A) and (D) Transverse sections of B73 mature leaf tip showing hybridization signal mainly in vascular tissues. (B), (C), (E) and (F). 40X magnification of individual vascular bundles showing signal in phloem, xylem parenchyma and sclerenchyma fiber cells. Bars= 200 μm in (A) and (D); 50 μm in (B), (C), (E) and (F).
9 A B sf sf vb Supplemental Figure 9. ZCN8 RNA in situ hybridization to leaf blade tissue from Gaspé Flint at stage V2 after the floral transition. (A)10X magnification of transverse sections of the Gaspé Flint leaf near the midrib at stage V2. (B) 20X magnification of vascular bundles (vb) near the midribs. ZCN8 RNA antisense probe signal appeared only in sclerenchyma fiber cells (sf) of the large vascular bundles. Bars=100 μm in (A); 50 μm in (B).
10 V3 V4 V5 V6 Supplemental Figure 10. GUS staining of shoot apices of ProZM-ADF4 :GUS transgenic plants. Shoot apices from plantsat stages V3- V6 were dissected and incubated at 37 C overnight in the dark in GUS staining solution. After incubation, tissues were washed several times with 70% ethanol at room temperature and stored at 4 C in 70% ethanol prior to imaging. ZM-ADF4 stands for Zea may Actin Depolymerizing Factor. Bar=100 μm.
11 TG NG Actin A B C ProZM-GOS2:ZCN7g ProUBI:ZCN26 ProUBI:ZCN18 D E F ProZM-ZMM4:ZCN8 ProZM-ADF4:ZCN8 ProUBI:amiR-ZCN TG Transgenic plants NG Event nulls TG NG Transgenic plants Event nulls NG Transgenic plants Event nulls Supplemental Figure 11. Expression analysis of transgene and native gene expression in transgenic plants. Transgene (TG) (A) ProZM-GOS2:ZCN7g, (B) ProUBI:ZCN26, (C) ProUBI:ZCN18 and native gene (NG) expression were determined by RT-PCR in leaves. PCR products were detected by ethidium bromide staining in agarose gels. T0 independent transgenic events were used. Two events highlighted by the white box were advanced to the T1 generation for analysis in the field. The expression of native ZCN7g includes native gene and transgene. The white arrow marked spliced ZCN7 mrnas. Quantitative ZCN8 transgene expression measured in leaves of transgenic plants (D) ProZM-ZMM4:ZCN8, (E) ProZM-ADF4:ZCN8 and (F) ProUBI: amir-zcn8. The relative expression of transgene (TG) and native gene (NG) were detected by qrt-pcr in leaf tissues. TG expression was normalized to Ubiquitin5. Note, due to the high level of transgene mrna in ProZM-ADF4:ZCN8 events, Expression of the native ZCN8 mrna can not be seen at this scale. numbers are shown over the bars.
12 Supplemental Data. Meng et al. (2011). Plant Cell /tpc Wild type 1 0 th le a f Non-transgenic sibling 1 0 th le a f Transgenic plant 1 0 th le a f Supplemental Figure 12. Images of non-transgenic and transgenic ProZM-ADF4:ZCN8 plants grown in the field.
13 AtFT (134) YAP-GWRQNFNTREFAEIYNLGLPVAAVFYNCQRESGCGGRRL AtTSF (134) YAP-GWRQQFNTREFAEIYNLGLPVAASYFNCQRENGCGGRRT BvFT2 (134) YAP-GWRQNFNTRDFAELYNLGLPVAAVYFNCQREGGSGGRRL ZCN14 (132) YAP-GWRQNFSTRDFAELYNLGLPVAAVYFNCQRESGTGGRRM ZCN15 (134) YAP-GWRQNFNTRDFAELYNLGPPVAAVYFNCQREAGSGGRRM ZCN16 (131) YAP-GWRQNFNTRDFSALYNLGPPVASVFFNCQRENGCGGRRY ZCN17 (134) YAP-GWRSNFNTRDFAAIYGLGSPVAAVYFNCQRENGCGGRRY ZCN18 (133) YAP-GWRQNFNIRDFSAIYNLGAPVAALYFNCQKESGVGGRR- ZCN19 (132) YAP-GWRQNFNTRDFSAFYNLGPPVAAVFFNCQRENGCGGRRY ZCN20 (133) YAP-GWRANFNTRDFAACYSLGPPVAATYFNCQREGGCGGRRY ZCN24 (133) YAP-GWRPNFNIRDFSAIYNLGPPVAALYFNCQKESGVGGRR- ZCN25 (131) YAP-GWRQNFNTRDFSALYNLGPPVAAVFFNCQRENGCGGRRY ZCN13 (131) YAP-SRRHNFSTRAFARRYNLGAPVAAMYFNCQRQNGSGGRRF BvFT1 (138) NAP-QQRQNFNTRDFAELYNLGLPVAAVYFNCQREGGCGGRRF ZCN26 (131) FAP-QVRQNFNLRNFARRFNLGKPVAATYFNCQRQTGTGGRRF ZCN12 (132) FAP-DMRHNFNCKSFARQYHLD-VVAATYFNCQREAGSGGRRF ZCN8 (132) FAP-EMRHNFNCRSFARQYHLS-IATATHFNCQREGGSGGRRF ZCN7 (132) FAP-EMRHNFNCRSFARQYHLS-IATATHFNCQREGGSGGRRF ZCN21 (133) FAAPSRRHNFSTRGFARRYNLGAPVAAMYFNCQRQTGSGGPRF Supplemental Figure 13. Partial amino sequence alignment of Arabidopsis, sugar beet and maize FT-like proteins Three amino acids, Asn(N)134, Gln(Q)137 and Gln(Q)138 that are the major cause of BvFT1 repressive function are in bold. Maize floral activator ZCN8 carries Phe(F)132, Glu(E)135 and Met(M)136 in these positions.
14 Table S1. The sequences of primers and probes Name Sequences (5 ->3 ) Purpose ZCN7-F ACACTTCAGCTATCTGGGTGACGTATGAC RT-PCR ZCN7-R CCATGCAGTGGTCTATGGTCTCTACTCT RT-PCR ZCN7-F CCAGCTTAGCGCTTACTGAAAGCCACTA In situ ZCN7-R AGTTTAAGGAACACTGAAGTGTGTGGGGAC In situ ZCN8-F AAGAGCAACGGCCAATACCATTAGCGA RT-PCR, in situ ZCN8-R CAGTGGCCTATGGTTTCTACTCTTCCCT RT-PCR, in situ ZCN12-F CCCAAGCAATCCATCACTGAGGGAGT RT-PCR ZCN12-R GTACGGGTCGGTGCATCTGATACCAA RT-PCR ZCN14-F CCAGCGATCCCAACCTCAGGGAGTACCT RT-PCR ZCN14-R ATTAATTTCCACCCGGCCGGGTCGAGATCA RT-PCR ZCN15-F CTAGCCAGCAGCAGGTAGTACCTTG RT-PCR ZCN15-R CATCCGATCACGAGTACATCCTCCTG RT-PCR ZCN18-F CACCTAGTTGTGGATCAACGAAGCTCTCTT RT-PCR ZCN18-R TCCTACCTTCTGCCACCAACACCACTT RT-PCR ZCN26-F TAGCATGGCTAATGACTCCTTGACGAGG RT-PCR, in situ ZCN26-R ATGCTACGTAGTGTACGCCGATACGG RT-PCR, in situ Ubiqutin5-F CCACTTCGACCGCCACTACT qrt-pcr Ubiqutin5-R CGCCTGCTGGTTGTAGACGTA qrt-pcr Ubiqutin5-Probe CGGTAAGTGTGGCCTC qrt-pcr ZCN8-F ACTTGCACTGGATGGTGACAGATA qrt-pcr ZCN8-R CGGCCTCTCATAAAATATTAGCTCTT qrt-pcr ZCN8-Probe CCAGAAACAACTAGTGTCAAC qrt-pcr ZCN18-F GGCACTGGACTACGAGCATCT qrt-pcr ZCN18-R GTCGTGGCCTTCAATCTCAAC qrt-pcr ZCN18-Probe CTGTGCTCAATGCAC qrt-pcr ZCN26-F TTGCATTGGATGGTTACTGACATC qrt-pcr ZCN26-R CTCTCATATGGTATGAGCTCTCGG qrt-pcr ZCN26-Probe AGCATCAACAGATGATAGC qrt-pcr gigz1-f GCAGAAAGTACATCAGCTCACCAA qrt-pcr gigz1-r TTGGTGAGGCTGAAACGACAT qrt-pcr gigz1-probe ATGGAGGAAGGTTGTTGAT qrt-pcr conz1-f GGTCAGTGCTTACACAGATTCCAT qrt-pcr conz1-r CCACCTCCATTGACGATGAGA qrt-pcr conz1-probe AGCAACAGCATCTCT qrt-pcr id1-f GCATCCTCTTCTCCAGGAAGG qrt-pcr id1-r CTCGCGCTCTCCTCTGCTA qrt-pcr id1-probe AGCCTGCTCACGCAC qrt-pcr
Supplemental Data. Benstein et al. (2013). Plant Cell /tpc
Supplemental Figure 1. Purification of the heterologously expressed PGDH1, PGDH2 and PGDH3 enzymes by Ni-NTA affinity chromatography. Protein extracts (2 µl) of different fractions (lane 1 = total extract,
Supplemental Data. Cui et al. (2012). Plant Cell /tpc a b c d. Stem UBC32 ACTIN
A Root Stem Leaf Flower Silique Senescence leaf B a b c d UBC32 ACTIN C * Supplemental Figure 1. Expression Pattern and Protein Sequence of UBC32 Homologues in Yeast, Human, and Arabidopsis. (A) Expression
(phosphatase tensin) domain is shown in dark gray, the FH1 domain in black, and the
Supplemental Figure 1. Predicted Domain Organization of the AFH14 Protein. (A) Schematic representation of the predicted domain organization of AFH14. The PTEN (phosphatase tensin) domain is shown in dark
Supplemental Figure 1. Floral commitment in Arabidopsis WT and mutants.
Percentage of induction Supplemental Data. Torti et al. (2012). Plant Cell 10.1105/tpc.111.092791 A +0 +0 LD LDs +1 LDs +3 +3 LDs +5 +5 LDs LD 50 μm AP1 B C 140 120 100 80 60 40 20 0-20 -40 wt Col soc1-2
Supplemental Data. Liu et al. (2013). Plant Cell /tpc
Supplemental Figure 1. The GFP Tag Does Not Disturb the Physiological Functions of WDL3. (A) RT-PCR analysis of WDL3 expression in wild-type, WDL3-GFP, and WDL3 (without the GFP tag) transgenic seedlings.
A Repressor Complex Governs the Integration of
Developmental Cell 15 Supplemental Data A Repressor Complex Governs the Integration of Flowering Signals in Arabidopsis Dan Li, Chang Liu, Lisha Shen, Yang Wu, Hongyan Chen, Masumi Robertson, Chris A.
sides of the aleurone (Al) but it is excluded from the basal endosperm transfer layer
Supplemental Data. Gómez et al. (2009). The maize transcription factor MRP-1 (Myb-Related-Protein-1) is a key regulator of the differentiation of transfer cells. Supplemental Figure 1. Expression analyses
WiscDsLox485 ATG < > //----- E1 E2 E3 E4 E bp. Col-0 arr7 ARR7 ACTIN7. s of mrna/ng total RNA (x10 3 ) ARR7.
A WiscDsLox8 ATG < > -9 +0 > ---------//----- E E E E E UTR +9 UTR +0 > 00bp B S D ol-0 arr7 ol-0 arr7 ARR7 ATIN7 D s of mrna/ng total RNA opie 0. ol-0 (x0 ) arr7 ARR7 Supplemental Fig.. Genotyping and
S156AT168AY175A (AAA) were purified as GST-fusion proteins and incubated with GSTfused
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 Supplemental Materials Supplemental Figure S1 (a) Phenotype of the wild type and grik1-2 grik2-1 plants after 8 days in darkness.
Supplementary Figure 1. Homozygous rag2 E450fs mutants are healthy and viable similar to wild-type and heterozygous siblings.
Supplementary Figure 1 Homozygous rag2 E450fs mutants are healthy and viable similar to wild-type and heterozygous siblings. (left) Representative bright-field images of wild type (wt), heterozygous (het)
Supplemental Data. Na Xu et al. (2016). Plant Cell /tpc
Supplemental Figure 1. The weak fluorescence phenotype is not caused by the mutation in At3g60240. (A) A mutation mapped to the gene At3g60240. Map-based cloning strategy was used to map the mutated site
Supplemental Figure 1. Immunoblot analysis of wild-type and mutant forms of JAZ3
Supplemental Data. Chung and Howe (2009). A Critical Role for the TIFY Motif in Repression of Jasmonate Signaling by a Stabilized Splice Variant of the JASMONATE ZIM-domain protein JAZ10 in Arabidopsis.
Pattern Formation via Small RNA Mobility SUPPLEMENTAL FIGURE 1 SUPPLEMENTAL INFORMATION. Daniel H. Chitwood et al.
SUPPLEMENTAL INFORMATION Pattern Formation via Small RNA Mobility Daniel H. Chitwood et al. SUPPLEMENTAL FIGURE 1 Supplemental Figure 1. The ARF3 promoter drives expression throughout leaves. (A, B) Expression
Supplemental Data. mir156-regulated SPL Transcription. Factors Define an Endogenous Flowering. Pathway in Arabidopsis thaliana
Cell, Volume 138 Supplemental Data mir156-regulated SPL Transcription Factors Define an Endogenous Flowering Pathway in Arabidopsis thaliana Jia-Wei Wang, Benjamin Czech, and Detlef Weigel Table S1. Interaction
Supplementary Figure 1. jmj30-2 and jmj32-1 produce null mutants. (a) Schematic drawing of JMJ30 and JMJ32 genome structure showing regions amplified
Supplementary Figure 1. jmj30-2 and jmj32-1 produce null mutants. (a) Schematic drawing of JMJ30 and JMJ32 genome structure showing regions amplified by primers used for mrna expression analysis. Gray
Supplemental Figure 1
12 1 8 Embryo 6 5 4 Silk 6 4 2 3 2 1 1 15 21 24 3 35 4 45 days after pollination 2 6 12 24 72 hours after pollination 35 6 3 25 2 15 1 5 Endosperm 8 12 21 22 3 35 4 45 days after pollination 5 4 3 2 1
Supplemental Figure 1.
Supplemental Data. Charron et al. Dynamic landscapes of four histone modifications during de-etiolation in Arabidopsis. Plant Cell (2009). 10.1105/tpc.109.066845 Supplemental Figure 1. Immunodetection
Supplemental data. Zhao et al. (2009). The Wuschel-related homeobox gene WOX11 is required to activate shoot-borne crown root development in rice.
Supplemental data. Zhao et al. (2009). The Wuschel-related homeobox gene WOX11 is required to activate shoot-borne crown root development in rice. A B Supplemental Figure 1. Expression of WOX11p-GUS WOX11-GFP
Alternative Cleavage and Polyadenylation of RNA
Developmental Cell 18 Supplemental Information The Spen Family Protein FPA Controls Alternative Cleavage and Polyadenylation of RNA Csaba Hornyik, Lionel C. Terzi, and Gordon G. Simpson Figure S1, related
Supplemental Data. Farmer et al. (2010) Plant Cell /tpc
Supplemental Figure 1. Amino acid sequence comparison of RAD23 proteins. Identical and similar residues are shown in the black and gray boxes, respectively. Dots denote gaps. The sequence of plant Ub is
Supplemental Data. Huo et al. (2013). Plant Cell /tpc
Supplemental Data. Huo et al. (2013). Plant Cell 10.1105/tpc.112.108902 1 Supplemental Figure 1. Alignment of NCED4 Amino Acid Sequences from Different Lettuce Varieties. NCED4 amino acid sequences are
Supplementary Information. Supplementary Figure S1. Phenotypic comparison of the wild type and mutants.
Supplementary Information Supplementary Figure S1. Phenotypic comparison of the wild type and mutants. Supplementary Figure S2. Transverse sections of anthers. Supplementary Figure S3. DAPI staining and
Figure S1. Figure S2 RT-PCR. qpcr RT-PCR. Northern. IVSwt ΔIVS IVS IVS IVS. NTC mock IVSwt ΔIVS IVS IVS. mock IVSwt ΔIVS
Figure S1 40 cycles IVS IVS IVS NTC wt Δ Δ mut pri-mirna163 * Fig. S1 Transcripts generated from the MIR163 gene variants in which splice sites have been mutated are not spliced. products were separated
Supplementary Materials: 1. Supplementary Figures S1-S9. 2. Supplementary Tables S1-S2
Supplementary Materials: 1. Supplementary Figures S1-S9 2. Supplementary Tables S1-S2 S1 1. Supplementary Figures Fig. S1. Genotypes of tcp20 mutants. Fig. S2. Root phenotypes of tcp20 mutants. Fig. S3.
Supplementary Information
Supplementary Information MED18 interaction with distinct transcription factors regulates plant immunity, flowering time and responses to hormones Supplementary Figure 1. Diagram showing T-DNA insertion
SUPPLEMENTARY INFORMATION
NaKR1 regulates long-distance movement of FLOWERING LOCUS T in Arabidopsis Supplementary Figure 1. NaKR1 is responsible for the late-flowering phenotype of nakr1-1. a, Schematic diagram shows the site
Supplemental Figure 1. VLN5 retains conserved residues at both type 1 and type 2 Ca 2+ -binding
Supplemental Figure 1. VLN5 retains conserved residues at both type 1 and type 2 Ca 2+ -binding sites in the G1 domain. Multiple sequence alignment was performed with DNAMAN6.0.40. Secondary structural
Supplemental Data. Wu et al. (2). Plant Cell..5/tpc RGLG Hormonal treatment H2O B RGLG µm ABA µm ACC µm GA Time (hours) µm µm MJ µm IA
Supplemental Data. Wu et al. (2). Plant Cell..5/tpc..4. A B Supplemental Figure. Immunoblot analysis verifies the expression of the AD-PP2C and BD-RGLG proteins in the Y2H assay. Total proteins were extracted
Supplemental Data. Zhang et al. (2010). Plant Cell /tpc
Supplemental Figure 1. uvs90 gene cloning The T-DNA insertion in uvs90 was identified using thermal asymmetric interlaced (TAIL)-PCR. Three rounds of amplification were performed; the second (2 nd ) and
Supplemental Data. Wang et al. (2017). Plant Cell /tpc NIP1;2 NIP7;1
Supplemental Data. Wang et al. (217). Plant Cell 1.115/tpc.16.825 NIP1;1 NIP1;2 NIP2;1 NIP3;1 NIP4;1 NIP5;1 NIP6;1 NIP7;1 Supplemental Figure 1. Distinct Localization of NIPs in Root Epidermal Cells. (Supports
SUPPLEMENTARY INFORMATION
AS-NMD modulates FLM-dependent thermosensory flowering response in Arabidopsis NATURE PLANTS www.nature.com/natureplants 1 Supplementary Figure 1. Genomic sequence of FLM along with the splice sites. Sequencing
Supplementary Figure 1 qrt-pcr expression analysis of NLP8 with and without KNO 3 during germination.
Supplementary Figure 1 qrt-pcr expression analysis of NLP8 with and without KNO 3 during germination. Seeds of Col-0 were harvested from plants grown at 16 C, stored for 2 months, imbibed for indicated
Supplemental Data. Sethi et al. (2014). Plant Cell /tpc
Supplemental Data Supplemental Figure 1. MYC2 Binds to the E-box but not the E1-box of the MPK6 Promoter. (A) E1-box and E-box (wild type) containing MPK6 promoter fragment. The region shown in red denotes
Supplementary Figures 1-12
Supplementary Figures 1-12 Supplementary Figure 1. The specificity of anti-abi1 antibody. Total Proteins extracted from the wild type seedlings or abi1-3 null mutant seedlings were used for immunoblotting
Revised: RG-RV2 by Fukuhara et al.
Supplemental Figure 1 The generation of Spns2 conditional knockout mice. (A) Schematic representation of the wild type Spns2 locus (Spns2 + ), the targeted allele, the floxed allele (Spns2 f ) and the
Supplemental Figure 1. Conserved regions of the kinase domain of PEPR1, PEPR2, CLV1 and BRI1.
Supplemental Figure 1. Conserved regions of the kinase domain of PEPR1, PEPR2, CLV1 and BRI1. The asterisks and colons indicate the important residues for ATP-binding pocket and substrate binding pocket,
Supplemental Data. Wang et al. Plant Cell. (2013) /tpc
SNL1 SNL Supplemental Figure 1. The Expression Patterns of SNL1 and SNL in Different Tissues of Arabidopsis from Genevestigator Web Site (https://www.genevestigator.com/gv/index.jsp). 1 A 1. 1..8.6.4..
GTTCGGGTTCC TTTTGAGCAG
Supplementary Figures Splice variants of the SIP1 transcripts play a role in nodule organogenesis in Lotus japonicus. Wang C, Zhu H, Jin L, Chen T, Wang L, Kang H, Hong Z, Zhang Z. 5 UTR CDS 3 UTR TCTCAACCATCCTTTGTCTGCTTCCGCCGCATGGGTGAGGTCATTTTGTCTAGATGACGTGCAATTTACAATGA
Sperm cells are passive cargo of the pollen tube in plant fertilization
In the format provided by the authors and unedited. SUPPLEMENTARY INFORMATION VOLUME: 3 ARTICLE NUMBER: 17079 Sperm cells are passive cargo of the pollen tube in plant fertilization Jun Zhang 1, Qingpei
At E17.5, the embryos were rinsed in phosphate-buffered saline (PBS) and immersed in
Supplementary Materials and Methods Barrier function assays At E17.5, the embryos were rinsed in phosphate-buffered saline (PBS) and immersed in acidic X-gal mix (100 mm phosphate buffer at ph4.3, 3 mm
Supplemental Data. Guo et al. (2015). Plant Cell /tpc
Supplemental Figure 1. The Mutant exb1-d Displayed Pleiotropic Phenotypes and Produced Branches in the Axils of Cotyledons. (A) Branches were developed in exb1-d but not in wild-type plants. (B) and (C)
Construction of plant complementation vector and generation of transgenic plants
MATERIAL S AND METHODS Plant materials and growth conditions Arabidopsis ecotype Columbia (Col0) was used for this study. SALK_072009, SALK_076309, and SALK_027645 were obtained from the Arabidopsis Biological
Supplemental Data. Wu and Xue (2010). Plant Cell /tpc
Supplemental Data. Wu and Xue (21). Plant Cell 1.115/tpc.11.75564 A P1-S P1-A P2-S P2-A P3-S P3-A P4-S P4-A B Relative expression Relative expression C 5. 4.5 4. 3.5 3. 2.5 2. 1.5 1..5 5. 4.5 4. 3.5 3.
Supplemental Data. Osakabe et al. (2013). Plant Cell /tpc
Supplemental Figure 1. Phylogenetic analysis of KUP in various species. The amino acid sequences of KUPs from green algae and land plants were identified with a BLAST search and aligned using ClustalW
Supplementary Fig 1. The responses of ERF109 to different hormones and stresses. (a to k) The induced expression of ERF109 in 7-day-old Arabidopsis
Supplementary Fig 1. The responses of ERF109 to different hormones and stresses. (a to k) The induced expression of ERF109 in 7-day-old Arabidopsis seedlings expressing ERF109pro-GUS. The GUS staining
- 1 - Supplemental Data
- 1-1 Supplemental Data 2 3 4 5 6 7 8 9 Supplemental Figure S1. Differential expression of AtPIP Genes in DC3000-inoculated plants. Gene expression in leaves was analyzed by real-time RT-PCR and expression
Supplemental Figure 1. Alignment of the NbGAPC amino acid sequences with their Arabidopsis homologues.
Supplemental Figure 1. Alignment of the NbGAPC amino acid sequences with their Arabidopsis homologues. Homologs from N. benthamiana (NbGAPC1, NbGAPC2, NbGAPC3), Arabidopsis (AtGAPC1, AT3G04120; AtGAPC2,
AD BD TOC1. Supplementary Figure 1: Yeast two-hybrid assays showing the interaction between
AD X BD TOC1 AD BD X PIFΔAD PIF TOC1 TOC1 PIFΔAD PIF N TOC1 TOC1 C1 PIFΔAD PIF C1 TOC1 TOC1 C PIFΔAD PIF C TOC1 Supplementary Figure 1: Yeast two-hybrid assays showing the interaction between PIF and TOC1
Supplemental Data. Zhang et al. Plant Cell (2014) /tpc
Supplemental Data. Zhang et al. Plant Cell (214) 1.115/tpc.114.134163 55 - T C N SDIRIP1-GFP 35-25 - Psb 18 - Histone H3 Supplemental Figure 1. Detection of SDIRIP1-GFP in the nuclear fraction by Western
SUPPLEMENTARY INFORMATION
doi:10.1038/nature12119 SUPPLEMENTARY FIGURES AND LEGENDS pre-let-7a- 1 +14U pre-let-7a- 1 Ddx3x Dhx30 Dis3l2 Elavl1 Ggt5 Hnrnph 2 Osbpl5 Puf60 Rnpc3 Rpl7 Sf3b3 Sf3b4 Tia1 Triobp U2af1 U2af2 1 6 2 4 3
Supporting Information
Supporting Information Deng et al. 10.1073/pnas.1102117108 Fig. S1. Predicted structure of Arabidopsis bzip60 RNA. Lowest free energy form (ΔG = 309.72 (initially 343.10) of bzip60 mrna folded by M-Fold
SUPPLEMENTARY INFORMATION
doi:10.1038/nature09861 & &' -(' ()*+ ')(+,,(','-*+,&,,+ ',+' ' 23,45/0*6787*9:./09 ;78?4?@*+A786?B- &' )*+*(,-* -(' ()*+ ')(+,,(','-*+,&,,+ ',+'./)*+*(,-*..)*+*(,-*./)*+*(,-*.0)*+*(,-*..)*+*(,-*
Morphogenesis of Ginkgo biloba leaf development Ellen Zelinsky August 2015 Abstract
Morphogenesis of Ginkgo biloba leaf development Ellen Zelinsky August 2015 Abstract Ginkgo biloba is a tree native to China, and the only extant species in its class. It is also known as a fossil species
Supplementary Table S1 qrt-pcr primers for the genes related to the flavonoid, lignin and starch metabolism pathways
Altered Phenylpropanoid Metabolism in the Maize Lc-Expressed Sweet Potato (Ipomoea batatas) Affects Storage Root Development. Hongxia Wang, JunYang, Min Zhang, Weijuan Fan, Nurit Firon, Sitakanta Pattanaik,
SUPPLEMENTARY INFORMATION
Ca 2+ /calmodulin Regulates Salicylic Acid-mediated Plant Immunity Liqun Du, Gul S. Ali, Kayla A. Simons, Jingguo Hou, Tianbao Yang, A.S.N. Reddy and B. W. Poovaiah * *To whom correspondence should be
8Br-cAMP was purchased from Sigma (St. Louis, MO). Silencer Negative Control sirna #1 and
1 Supplemental information 2 3 Materials and Methods 4 Reagents and animals 5 8Br-cAMP was purchased from Sigma (St. Louis, MO). Silencer Negative Control sirna #1 and 6 Silencer Select Pre-designed sirna
Supplemental Data. Seo et al. (2014). Plant Cell /tpc
Supplemental Figure 1. Protein alignment of ABD1 from other model organisms. The alignment was performed with H. sapiens DCAF8, M. musculus DCAF8 and O. sativa Os10g0544500. The WD40 domains are underlined.
Supplementary Information. c d e
Supplementary Information a b c d e f Supplementary Figure 1. atabcg30, atabcg31, and atabcg40 mutant seeds germinate faster than the wild type on ½ MS medium supplemented with ABA (a and d-f) Germination
Supplementary Information. The flowering gene SINGLE FLOWER TRUSS drives heterosis for yield in tomato
Supplementary Information The flowering gene SINGLE FLOWER TRUSS drives heterosis for yield in tomato Uri Krieger 1, Zachary B. Lippman 2 *, and Dani Zamir 1 * 1. The Hebrew University of Jerusalem Faculty
Supplemental Data. Ohnishi et al. Plant Cell. (2010) /tpc anti-lci1 NH 4+ NO 3- DAPI IF DAPI IF
Supplemental Data. Ohnishi et al. Plant Cell. (2010). 10.1105/tpc.109.071811 A DAPI HC IF DAPI LC IF antilci1 B DAPI IF DAPI IF C2 E4 Supplemental Figure 1. Indirect immunofluorescence analyses of LCI1
Functional conservation and diversification of the soybean maturity gene E1 and its homologs in legumes
Functional conservation and diversification of the soybean maturity gene E1 and its homologs in legumes Xingzheng Zhang 1,2#, Hong Zhai 1#, Yaying Wang 1,2, Xiaojie Tian 1,2, Yupeng Zhang 1,2, Hongyan
Supplementary information, Figure S1
Supplementary information, Figure S1 (A) Schematic diagram of the sgrna and hspcas9 expression cassettes in a single binary vector designed for Agrobacterium-mediated stable transformation of Arabidopsis
Figure S1. Figure S2. Figure S3 HB Anti-FSP27 (COOH-terminal peptide) Ab. Anti-GST-FSP27(45-127) Ab.
/ 36B4 mrna ratio Figure S1 * 2. 1.6 1.2.8 *.4 control TNFα BRL49653 Figure S2 Su bw AT p iw Anti- (COOH-terminal peptide) Ab Blot : Anti-GST-(45-127) Ab β-actin Figure S3 HB2 HW AT BA T Figure S4 A TAG
Supplemental Data. Borg et al. Plant Cell (2014) /tpc
Supplementary Figure 1 - Alignment of selected angiosperm DAZ1 and DAZ2 homologs Multiple sequence alignment of selected DAZ1 and DAZ2 homologs. A consensus sequence built using default parameters is shown
Confocal immunofluorescence microscopy
Confocal immunofluorescence microscopy HL-6 and cells were cultured and cytospun onto glass slides. The cells were double immunofluorescence stained for Mt NPM1 and fibrillarin (nucleolar marker). Briefly,
Supplemental Data. Steiner et al. Plant Cell. (2012) /tpc
Supplemental Figure 1. SPY does not interact with free GST. Invitro pull-down assay using E. coli-expressed MBP-SPY and GST, GST-TCP14 and GST-TCP15. MBP-SPY was used as bait and incubated with equal amount
Supplemental Figure 1 HDA18 has an HDAC domain and therefore has concentration dependent and TSA inhibited histone deacetylase activity.
Supplemental Figure 1 HDA18 has an HDAC domain and therefore has concentration dependent and TSA inhibited histone deacetylase activity. (A) Amino acid alignment of HDA5, HDA15 and HDA18. The blue line
Wheat TILLING Mutants Show That the Vernalization Gene VRN1 Down-Regulates the Flowering Repressor VRN2 in Leaves but Is Not Essential for Flowering
Wheat TILLING Mutants Show That the Vernalization Gene VRN1 Down-Regulates the Flowering Repressor VRN2 in Leaves but Is Not Essential for Flowering Andrew Chen 1, Jorge Dubcovsky 1,2,3 * 1 Department
PIE1 ARP6 SWC6 KU70 ARP6 PIE1. HSA SNF2_N HELICc SANT. pie1-3 A1,A2 K1,K2 K1,K3 K3,LB2 A3, A4 A3,LB1 A1,A2 K1,K2 K1,K3. swc6-1 A3,A4.
A B N-terminal SWC2 H2A.Z SWC6 ARP6 PIE1 HSA SNF2_N HELICc SANT C pie1-3 D PIE1 ARP6 5 Kb A1 200 bp A3 A2 LB1 arp6-3 A4 E A1,A2 A3, A4 A3,LB1 K1,K2 K1,K3 K3,LB2 SWC6 swc6-1 A1,A2 A3,A4 K1,K2 K1,K3 100
Supplementary Fig.1. Over-expression of RNase L in stable polyclonal cell line
Supplemental Data mrna Protein A kda 75 40 NEO/vector NEO/RNase L RNASE L β-actin RNASE L β-actin B % of control (neo vector), normalized 240 ** 200 160 120 80 40 0 Neo Neo/RNase L RNase L Protein Supplementary
Supplemental Information
Supplemental Information Supplemental Figure 1. The Heterologous Yeast System for Screening of Arabidopsis JA Transporters. (A) Exogenous JA inhibited yeast cell growth. Yeast cells were diluted to various
SUPPLEMENTAL DATA. Supplementary data
1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 SUPPLEMENTAL DATA Supplementary data Figure S1: Verification of pla-iα1 knockdown lines a: Semiquantitative
Abcam.com. hutton.ac.uk. Ipmdss.dk. Bo Gong and Eva Chou
Abcam.com Bo Gong and Eva Chou Ipmdss.dk hutton.ac.uk What is a homeotic gene? A gene which regulates the developmental fate of anatomical structures in an organism Why study them? Understand the underlying
Supplemental Figure 1
Supplemental Figure 1 A gta2-1 gta2-2 1kb AT4G08350 B Col-0 gta2-1 LP+RP+LBb1.3 C Col-0 gta2-2 LP+RP+LB1 D Col-0 gta2-2 gta2-1 GTA2 TUBLIN E Col0 gta2-1 gta2-2 Supplemental Figure 1. Phenotypic analysis
Supplemental Data. Challa et al. (2016). Plant Cell /tpc
Supplemental Figure 1. DEX-induced TCP4 activity rescues jaw-d phenotypes. (A) and (B) Rosettess of 32-day-old Col-0;ProTCP4:mTCP4:GR plants (A) and jaw-d;protcp4:mtcp4:gr (B) plants grown in mock or in
Rapid and Efficient RNA Isolation Protocol from Various Recalcitrant Tissues of Mango (Mangifera indica L.)
Rapid and Efficient RNA Isolation Protocol from Various Recalcitrant Tissues of Mango (Mangifera indica L.) R.R. Sharma and S. V. R. Reddy Division of Food Science and Postharvest Technology, ICAR-Indian
Supplemental Information. Boundary Formation through a Direct. Threshold-Based Readout. of Mobile Small RNA Gradients
Developmental Cell, Volume 43 Supplemental Information Boundary Formation through a Direct Threshold-Based Readout of Mobile Small RNA Gradients Damianos S. Skopelitis, Anna H. Benkovics, Aman Y. Husbands,
Supplemental Figure legends Figure S1. (A) (B) (C) (D) Figure S2. Figure S3. (A-E) Figure S4. Figure S5. (A, C, E, G, I) (B, D, F, H, Figure S6.
Supplemental Figure legends Figure S1. Map-based cloning and complementation testing for ZOP1. (A) ZOP1 was mapped to a ~273-kb interval on Chromosome 1. In the interval, a single-nucleotide G to A substitution
Nature Genetics: doi: /ng.3556 INTEGRATED SUPPLEMENTARY FIGURE TEMPLATE. Supplementary Figure 1
INTEGRATED SUPPLEMENTARY FIGURE TEMPLATE Supplementary Figure 1 REF6 expression in transgenic lines. (a,b) Expression of REF6 in REF6-HA ref6 and REF6ΔZnF-HA ref6 plants detected by RT qpcr (a) and immunoblot
Fig. S1. TPL and TPL N176H protein interactions. (A) Semi-in vivo pull-down assays using recombinant GST N-TPL and GST N-TPL N176H fusions and
Fig. S1. TPL and TPL N176H protein interactions. (A) Semi-in vivo pull-down assays using recombinant GST N-TPL and GST N-TPL N176H fusions and transgenic Arabidopsis TPL-HA lysates. Immunoblotting of input
Fig Hypoxia causes growth retardation and developmental delay. (A) Morphology of wildtype zebrafish embryos at 48 hours post fertilization
FIGURES AND TABLES Fig. 1-1. Hypoxia causes growth retardation and developmental delay. (A) Morphology of wildtype zebrafish embryos at 48 hours post fertilization (hpf) after 24 h of normoxia or hypoxia
Supplemental Data. Zhou et al. (2016). Plant Cell /tpc
Supplemental Figure 1. Confirmation of mutant mapping results. (A) Complementation assay with stably transformed genomic fragments (ComN-N) (2 kb upstream of TSS and 1.5 kb downstream of TES) and CaMV
Supplemental Data Supplemental Figure 1.
Supplemental Data Supplemental Figure 1. Silique arrangement in the wild-type, jhs, and complemented lines. Wild-type (WT) (A), the jhs1 mutant (B,C), and the jhs1 mutant complemented with JHS1 (Com) (D)
Supplemental Data. Hachez et al. Plant Cell (2014) /tpc Suppl. Figure 1A
Suppl. Figure 1A Suppl. Figure 1B Supplemental Figure 1: Results of the commercial screening of interactants using split ubiquitin technique. (A) Isolated preys (192) using the bait construct pbt3-n- as
SUPPLEMENTARY INFORMATION
Gene replacements and insertions in rice by intron targeting using CRISPR Cas9 Table of Contents Supplementary Figure 1. sgrna-induced targeted mutations in the OsEPSPS gene in rice protoplasts. Supplementary
Molecular Techniques. 3 Goals in Molecular Biology. Nucleic Acids: DNA and RNA. Disclaimer Nucleic Acids Proteins
Molecular Techniques Disclaimer Nucleic Acids Proteins Houpt, CMN, 9-30-11 3 Goals in Molecular Biology Identify All nucleic acids (and proteins) are chemically identical in aggregate - need to identify
Table S1. Primers used in the study
Table S1. Primers used in the study Primer name Application Sequence I1F16 Genotyping GGCAAGTGAGTGAGTGCCTA I1R11 Genotyping CCCACTCGTATTGACGCTCT V19 Genotyping GGGTCTCAAAGTCAGGGTCA D18Mit184-F Genotyping
Molecular Cloning and Expression Analysis of a Zinc Finger Protein Gene in Apple
Acta Botanica Sinica 2004, 46 (9): 1091 1099 http://www.chineseplantscience.com Molecular Cloning and Expression Analysis of a Zinc Finger Protein Gene in Apple CAO Qiu-Fen 1*, Masato WADA 2, MENG Yu-Ping
-RT RT RT -RT XBMPRII
Base pairs 2000 1650 1000 850 600 500 400 Marker Primer set 1 Primer set 2 -RT RT RT -RT XBMPRII kda 100 75 50 37 25 20 XAC p-xac A 300 B Supplemental figure 1. PCR analysis of BMPRII expression and western
Supplemental Figure 1 Human REEP family of proteins can be divided into two distinct subfamilies. Residues (single letter amino acid code) identical
Supplemental Figure Human REEP family of proteins can be divided into two distinct subfamilies. Residues (single letter amino acid code) identical in all six REEPs are highlighted in green. Additional
A subclass of HSP70s regulate development and abiotic stress responses in Arabidopsis thaliana
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 Journal of Plant Research A subclass of HSP70s regulate development and abiotic stress responses in Arabidopsis thaliana Linna Leng 1 Qianqian Liang
Supplemental Data. Hu et al. Plant Cell (2017) /tpc
1 2 3 4 Supplemental Figure 1. DNA gel blot analysis of homozygous transgenic plants. (Supports Figure 1.) 5 6 7 8 Rice genomic DNA was digested with the restriction enzymes EcoRⅠ and BamHⅠ. Lanes in the
Supplemental Data. Furlan et al. Plant Cell (2017) /tpc
Supplemental Data. Furlan et al. Plant Cell (0) 0.0/tpc..00. Supplemental Data. Furlan et al. Plant Cell (0) 0.0/tpc..00. Supplemental Data. Furlan et al. Plant Cell (0) 0.0/tpc..00. Supplemental Figure.
Supplemental Data. Ondzighi-Assoume et al. Plant Cell (2016) /tpc G 60
Supplemental ata. Ondzighi-Assoume et al. Plant ell (26).5/tpc.5.946 ABA/Alexa 488 Merge Bright-field luorescence intensity A G 6 Average of fluorescence intensity of endodermis B Z 4 a a RAM 2 c Supplemental
B. Transgenic plants with strong phenotype (%)
A. TCTAGTTGTTGTTGTTATGGTCTAGTTGTTGTTGTTATGGTCTAATTT AAATATGGTCTAAAGAAGAAGAATATGGTCTAAAGAAGAAGAATATGG 2XP35S STTM165 5 GGGGGATGAAGctaCCTGGTCCGA3 3 CCCCCUACUUC---GGACCAGGCU5 mir165 HindIII mir165 96 nt GTTGTTGTTGTTATGGTCTAGTTGTTGTTGTTATGGTCTAATTT
A Nucleus-Encoded Chloroplast Protein YL1 Is Involved in Chloroplast. Development and Efficient Biogenesis of Chloroplast ATP Synthase in Rice
A Nucleus-Encoded Chloroplast Protein YL1 Is Involved in Chloroplast Development and Efficient Biogenesis of Chloroplast ATP Synthase in Rice Fei Chen 1,*, Guojun Dong 2,*, Limin Wu 1, Fang Wang 3, Xingzheng
Supplementary Figure 1. Characterization of the POP2 transcriptional and post-transcriptional regulatory elements. (A) POP2 nucleotide sequence
1 5 6 7 8 9 10 11 1 1 1 Supplementary Figure 1. Characterization of the POP transcriptional and post-transcriptional regulatory elements. (A) POP nucleotide sequence depicting the consensus sequence for
Supplemental Data. Yang et al. (2014). Plant Cell /tpc
Supplemental Figure 1. Activities of the Cm-BBX24 promoter in response to hormone treatments and abiotic stresses in transgenic Arabidopsis plants. (A) Cis-element analysis of the Cm-BBX24 promoter. (B)
Poly-A signals. amirna. pentr/d-topo for Gateway cloning
popon inducible system A Poly-A signals CaMV 35S minimal promoter TMV omega translational enhancer HYG KAN RR 35S 35S LhGR GUS Ω pop6 Ω Gene construct B - Dex + Dex CACC prs300 (mir319a) CACC amirna pentr/d-topo
Genetics of Plant-Pathogen Interactions (Plant Immunity) Topics on Systemic Acquired Resistance (SAR)
Genetics of Plant-Pathogen Interactions (Plant Immunity) Topics on Systemic Acquired Resistance (SAR) Major types of plant pathogens - Bacteria - Fungi (>80% loss) - Viruses - Viroid Can you name a few