PHT1;2-CFP YFP-PHF + PHT1;2-CFP YFP-PHF

Size: px
Start display at page:

Download "PHT1;2-CFP YFP-PHF + PHT1;2-CFP YFP-PHF"

Transcription

1 YFP-PHF1 CFP-PHT1;2 PHT1;2-CFP YFP-PHF + PHT1;2-CFP YFP-PHF + CFP-PHT1;2 Negative control!-gfp Supplemental Figure 1: PHT1;2 accumulation is PHF1 dependent. Immunoblot analysis on total protein extract corresponding to transient expression in N. benthamiana leaf epidermis 48h postinfiltration presented in figure 2. Protein detection is done using anti-gfp antibodies recognizing YFP-PHF1 (75kDa dark arrow) or CFP-PHT1;2 fusion proteins (90kDa white arrow). Coomassie blue acrylamide gel staining is shown as protein loading control. 1

2 PHF1-GFP ST-mRFP Merging D E F BFA 50!M 120min PHF1-GFP ST-mRFP Merging Supplemental Figure 2: Strict ER localization of PHF1. (A-F) A. thaliana epidermal root cells expressing PHF1-GFP under control of its own promoter (A) and Golgi marker ST-mRFP (B). (C-D) same line with BFA treatment (50!M, 2 hours). Scale bar:10!m. 2

3 YFP-channel Supplemental Figure 3: PHT1;2-CFP export from ER is COPII-dependent (A-L) Transient protein expression in N. benthamiana epidermal cells analyzed by confocal microscopy 48h post-infiltration. Transient expression of PHT1;2-CFP alone (B) showing weak plasma membrane fluorescence, together with Sec12-YFP (D-I) blue fluorescence is retained in ER structure with Sec12-YFP. Co-expression of PHT1;2-CFP together with YFP-PHF1 (J-L) shows an increase of blue fluorescence, colocalization at the ER and correct targeting of PHT1;2-CFP to the plasma membrane. Scale bars are 10µm. 3

4 Supplemental Figure 4: PHF1 is not associated with recruitment of COPII components to ERES. (A-L) Transient protein expression in N. benthamiana epidermal cells analyzed by confocal microscopy 48h post-infiltration. Transient expression ERES marker YFP-Sec24 expressed alone (B), or together with ST-CFP (G-I), PHT1;2-CFP (J- L) or CFP-PHF1 (J-L). YFP-Sec24 mainly localizes to cytoplasm and is recruited to ERES (white arrows). Scale bars are 10µm. 4

5 CFP-channel Sar1-YFP Merging CFP-PHF1 Sar1-YFP Merging G H I PHT1;2-CFP YFP-channel Merging J K L PHT1;2-CFP Sar1-YFP Merging Supplemental Figure 5: Co-expression of PHF1 and PHT1;2-CFP fusion protein together with ERES marker SAR1. (A-L) Transient protein expression in N. benthamiana epidermal cells analyzed by confocal microscopy 48h post-infiltrations. Transient expression of SAR1-YFP alone (B) or together with CFP-PHF1 (D-F) or PHT1;2-CFP (J-L). Transient expression PHT1;2-CFP alone is indicated as control (G-I) Scale bars = 10!M. 5

6 Supplemental Figure 6: MS/MS fragmentation spectrum of the diphosphopeptide SLEEL(pS)GEAEV(pS)HDEK (PHT1.1). Attributed y and b ions are indicated on the spectrum. Double Neutral Loss (NL) was present. S*: identified phosphorylated serine after neutral loss. 6

7 Control treatment M Control treatment PHT1;1-GFP 0!M Pi 500!M Pi N r =0,51±0,09 r = 0,53 SNX1-mRFP PHT1;1-GFP r = 0,55 SNX1-mRFP 0!M Pi 500!M Pi r r =0,0±0,034 r =0,53±0,09 r r =0,0±0,05 Supplemental Figure 7: Sorting endosomes localization of PHT1;1 independently of Pi external content. A. thaliana root tip cells co-expressing PHT1;1- GFP and the sorting endosome marker SNX1- mrfp, 60 minutes after 33!M Wm treatment. Plants were cultivated on Pi depleted medium (A-F) or Pi (500!M) containing medium (G-L) prior to treatment. (M) Quantitative analysis of intracellular colocalization between PHT1;1-GFP and SNXmRFP, cytofluorogram obtain for two images, (N) average Pearson s coefficient (r) and after Coste randomization based colocalization (r r ) are given. Scale bars = 5!M. The Pearson s coefficient was calculated based on the analysis of 350 root tip cells from 20 plants per condition. 7

8 A CHX 50!M T0 B T2 C T7 Control treatment D T7 -P E T0 F T2 G T7 H T7 +P Supplemental Figure 8: Kinetic analysis of Pi-induced PHT1 degradation. A. thaliana root tip cells co-expressing PHT1;1-GFP cultivated on medium containing 0!M (A-D) Pi or 500!M (E-H). (A and E) prior to drug treatment; (B and F) 2 hours and (C and G) 7 hours after CHX (50!M) treatment. (H and L) control untreated after 7 hours. Scale bars are 10!m 8

9 A relative fluorescence (AU) Inhibition 26S proteasome test P500 B relative fluorescence T0 2h CHX 6h MG132 2h CHX Effect of pho2-1 mutation on PHT1;1:GFP degradation P500 T0 2h CHX 0 PHT1;1 pho2 N 1 pho2 N 2 Supplemental Figure 9: Pi induced PHT1 degradation is not affected by MG-132 treatment or pho2-1 mutation. Relative fluorescence intensity of PHT1;1-GFP observed in root of plant grown on +Pi (500!M). (A) Effect of MG132 treatment (6h, 50!M), CHX was added during the two last hours (50!M). (B) Effect of pho2-1 mutation, PHT1;1-GFP marker was introgressed into pho2-1 mutant and treated with CHX drugs as previously described. For each experiment, 12 lateral roots were observed. The fluorescence from 20 (A) or 25 (B) regions of interests for each sample was quantified. The mean and standard deviation from the measurements are indicated here for one of the experiments performed. 9

10 A T0 B T15min C T60min 0!M Pi 500!M Pi D T0 E T15min F T60min Supplemental Figure 10 : Phosphate starvation does not affect internalization of endocytic tracer FM4-64 in root cells. Seedlings cultivatedeither in 500!M Pi (A to C) or Pi deprived (D to F) medium were subjected to kinetic analysis of FM4-64 internalization. Short time (A, B, D and E) shows endocytic tracer at the plasma membrane and endosomes, longer time shows tonoplast staining (C and F). Scale bar=5!m 10

11 Table 1 : Primers used for amplification and site-directed mutagenesis of PHT1;1 forward primer reverse primer PHT1;1 cdna 5'-CACCATGGCCGAACAACAACTAGG-3' 5'-TTTCTCGTCATGGCTAACCTCA-3' PHT1;1-S148A 5'-GTGACTACCCACTTGCTGCCACCATCATGTC-3' 5'-GACATGATGGTGGCAGCAAGTGGGTAGTCAC-3' PHT1;1-S148D 5'-GTGACTACCCACTTGATGCCACCATCATGTC-3' 5'-GACATGATGGTGGCATCAAGTGGGTAGTCAC-3' PHT1;1-S153A 5'-TGCCACCATCATGGCTGAATACGCAAACA-3' 5'-TGTTTGCGTATTCAGCCATGATGGTGGCA-3' PHT1;1-S153D 5'-TGCCACCATCATGGATGAATACGCAAACA-3' 5'-TGTTTGCGTATTCATCCATGATGGTGGCA-3' PHT1;1-T160A 5'-CGCAAACAAGAAGGCCCGTGGGGCTTTCA-3' 5'-TGAAAGCCCCACGGGCCTTCTTGTTTGCG-3' PHT1;1-T160D 5'-CGCAAACAAGAAGGACCGTGGGGCTTTCA-3' 5'-TGAAAGCCCCACGGTCCTTCTTGTTTGCG-3' PHT1;1-T239A 5'-GAAGATGCCTGAAGCTGCCCGTTACACCG-3' 5'-CGGTGTAACGGGCAGCTTCAGGCATCTTC-3' PHT1;1-T239D 5'-GAAGATGCCTGAAGATGCCCGTTACACCG-3' 5'-CGGTGTAACGGGCATCTTCAGGCATCTTC-3' PHT1;1-T368A 5'-GCGTTTATTGATGCCATTGGAAGGTTT-3' 5'-AAACCTTCCAATGGCATCAATAAACGC-3' PHT1;1-T368D 5'-GCGTTTATTGATGACATTGGAAGGTTT-3' 5'-AAACCTTCCAATGTCATCAATAAACGC-3' PHT1;1-S438A 5'-GGCCAGGCTAAGGGCTACATGTCATGGAA-3' 5'-TTCCATGACATGTAGCCCTTAGCCTGGCC-3' PHT1;1-S438D 5'-GGCCAGGCTAAGGGATACATGTCATGGAA-3' 5'-TTCCATGACATGTATCCCTTAGCCTGGCC-3' PHT1;1-S509A 5'-GCCCAAAGGCAAGGCCCTTGAAGAACTCT-3' 5'-AGAGTTCTTCAAGGGCCTTGCCTTTGGGC-3' PHT1;1-S509D 5'-GCCCAAAGGCAAGGACCTTGAAGAACTCT-3' 5'-AGAGTTCTTCAAGGTCCTTGCCTTTGGGC-3' PHT1;1-S514A 5'-CCTTGAAGAACTCGCTGGTGAGGCTGAGG-3' 5'-CCTCAGCCTCACCAGCGAGTTCTTCAAGG-3' PHT1;1-S514D 5'-CCTTGAAGAACTCGATGGTGAGGCTGAGG-3' 5'-CCTCAGCCTCACCATCGAGTTCTTCAAGG-3' PHT1;1-S520A 5'-TGAGGCTGAGGTTGCCCATGACGAGAAA-3' 5'-TTTCTCGTCATGGGCAACCTCAGCCTCA-3' PHT1;1-S520D 5'-TGAGGCTGAGGTTGACCATGACGAGAAA-3' 5'-TTTCTCGTCATGGTCAACCTCAGCCTCA-3' The CACC sequence allowing a directional cloning of PHT1;1 cdna into pentr is shown in bold. For site-directed mutagenesis, the subsitution sites for Ser and Thr in the primers to generate the mutations are underlined. 11

Supplemental Figure 1. Mutation in NLA Causes Increased Pi Uptake Activity and

Supplemental Figure 1. Mutation in NLA Causes Increased Pi Uptake Activity and Supplemental Figure 1. Mutation in NLA Causes Increased Pi Uptake Activity and PHT1 Protein Amounts. (A) Shoot morphology of 19-day-old nla mutants under Pi-sufficient conditions. (B) [ 33 P]Pi uptake

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION Legends for Supplementary Tables. Supplementary Table 1. An excel file containing primary screen data. Worksheet 1, Normalized quantification data from a duplicated screen: valid

More information

Transport of Potato Lipoxygenase into the Vacuole Larsen, Mia Kruse Guldstrand; Welinder, Karen Gjesing; Jørgensen, Malene

Transport of Potato Lipoxygenase into the Vacuole Larsen, Mia Kruse Guldstrand; Welinder, Karen Gjesing; Jørgensen, Malene Aalborg Universitet Transport of Potato Lipoxygenase into the Vacuole Larsen, Mia Kruse Guldstrand; Welinder, Karen Gjesing; Jørgensen, Malene Publication date: 2009 Document Version Publisher's PDF, also

More information

a. Primers were purchased from Display Systems Biotech and are listed numerically to differentiate them

a. Primers were purchased from Display Systems Biotech and are listed numerically to differentiate them Table 2-1. Random upstream primers used in fluorescence differential display. Upstream primer a Sequence 1 5 GATCATAGCC 2 5 CTGCTTGATG 3 5 GATCCAGTAC 4 5 GATCGCATTG 5 5 AAACTCCGTC 6 5 TGGTAAAGGG 7 5 GATCATGGTC

More information

A 5 P degradation hot spot influences molecular farming of anticancerogenic nuclease TBN1 in tobacco cells

A 5 P degradation hot spot influences molecular farming of anticancerogenic nuclease TBN1 in tobacco cells Plant Cell, Tissue and Organ Culture (PCTOC) A 5 P degradation hot spot influences molecular farming of anticancerogenic nuclease TBN1 in tobacco cells Anna Týcová a,b, Rajen J. J. Piernikarczyk c, Michael

More information

MOK. Media Optimization Kit

MOK. Media Optimization Kit MOK Media Optimization Kit The Media Optimization Kit determines the best medium formulation for maximizing accumulation of recombinant proteins expressed in E. coli, utilizing a series of Athena s superior

More information

7.17: Writing Up Results and Creating Illustrations

7.17: Writing Up Results and Creating Illustrations 7.17: Writing Up Results and Creating Illustrations A Results Exercise: Kansas and Pancakes Write a 5-sentence paragraph describing the results illustrated in this figure: - Describe the figure: highlights?

More information

The Human Protein PRR14 Tethers Heterochromatin to the Nuclear Lamina During Interphase and Mitotic Exit

The Human Protein PRR14 Tethers Heterochromatin to the Nuclear Lamina During Interphase and Mitotic Exit Cell Reports, Volume 5 Supplemental Information The Human Protein PRR14 Tethers Heterochromatin to the Nuclear Lamina During Interphase and Mitotic Exit Andrey Poleshko, Katelyn M. Mansfield, Caroline

More information

Figure S1. Figure S2. Figure S3 HB Anti-FSP27 (COOH-terminal peptide) Ab. Anti-GST-FSP27(45-127) Ab.

Figure S1. Figure S2. Figure S3 HB Anti-FSP27 (COOH-terminal peptide) Ab. Anti-GST-FSP27(45-127) Ab. / 36B4 mrna ratio Figure S1 * 2. 1.6 1.2.8 *.4 control TNFα BRL49653 Figure S2 Su bw AT p iw Anti- (COOH-terminal peptide) Ab Blot : Anti-GST-(45-127) Ab β-actin Figure S3 HB2 HW AT BA T Figure S4 A TAG

More information

over time using live cell microscopy. The time post infection is indicated in the lower left corner.

over time using live cell microscopy. The time post infection is indicated in the lower left corner. Title of file for HTML: Supplementary Information Description: Supplementary Figures and Supplementary Table Title of file for HTML: Supplementary Movie 1 Description: Fusion of NBs. BSR cells were infected

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION Dynamic Phosphorylation of HP1 Regulates Mitotic Progression in Human Cells Supplementary Figures Supplementary Figure 1. NDR1 interacts with HP1. (a) Immunoprecipitation using

More information

A subclass of HSP70s regulate development and abiotic stress responses in Arabidopsis thaliana

A subclass of HSP70s regulate development and abiotic stress responses in Arabidopsis thaliana 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 Journal of Plant Research A subclass of HSP70s regulate development and abiotic stress responses in Arabidopsis thaliana Linna Leng 1 Qianqian Liang

More information

Confocal immunofluorescence microscopy

Confocal immunofluorescence microscopy Confocal immunofluorescence microscopy HL-6 and cells were cultured and cytospun onto glass slides. The cells were double immunofluorescence stained for Mt NPM1 and fibrillarin (nucleolar marker). Briefly,

More information

Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table.

Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table. Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table. Name Sequence (5-3 ) Application Flag-u ggactacaaggacgacgatgac Shared upstream primer for all the amplifications of

More information

Supplemental Information. Boundary Formation through a Direct. Threshold-Based Readout. of Mobile Small RNA Gradients

Supplemental Information. Boundary Formation through a Direct. Threshold-Based Readout. of Mobile Small RNA Gradients Developmental Cell, Volume 43 Supplemental Information Boundary Formation through a Direct Threshold-Based Readout of Mobile Small RNA Gradients Damianos S. Skopelitis, Anna H. Benkovics, Aman Y. Husbands,

More information

Supplementary Figure 1 qrt-pcr expression analysis of NLP8 with and without KNO 3 during germination.

Supplementary Figure 1 qrt-pcr expression analysis of NLP8 with and without KNO 3 during germination. Supplementary Figure 1 qrt-pcr expression analysis of NLP8 with and without KNO 3 during germination. Seeds of Col-0 were harvested from plants grown at 16 C, stored for 2 months, imbibed for indicated

More information

MIT Department of Biology 7.013: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr.

MIT Department of Biology 7.013: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr. MIT Department of Biology 7.01: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr. Claudette Gardel iv) Would Xba I be useful for cloning? Why or why not?

More information

Alternative Cleavage and Polyadenylation of RNA

Alternative Cleavage and Polyadenylation of RNA Developmental Cell 18 Supplemental Information The Spen Family Protein FPA Controls Alternative Cleavage and Polyadenylation of RNA Csaba Hornyik, Lionel C. Terzi, and Gordon G. Simpson Figure S1, related

More information

The Conserved Isoleucine Valine Phenylalanine Motif Couples Activation State and Endocytic Functions of b-arrestins

The Conserved Isoleucine Valine Phenylalanine Motif Couples Activation State and Endocytic Functions of b-arrestins Traffic 2007 Blackwell Munksgaard # 2007 The Authors doi: 10.1111/j.1600-0854.2007.00578.x The Conserved Isoleucine Valine Phenylalanine Motif Couples Activation State and Endocytic Functions of b-arrestins

More information

Supplemental Movie Legend.

Supplemental Movie Legend. Supplemental Movie Legend. Transfected T cells were dropped onto SEE superantigen-pulsed Raji B cells (approximate location indicated by circle). Maximum-intensity projections from Z-stacks (17 slices,

More information

Molecular Cell Biology - Problem Drill 11: Recombinant DNA

Molecular Cell Biology - Problem Drill 11: Recombinant DNA Molecular Cell Biology - Problem Drill 11: Recombinant DNA Question No. 1 of 10 1. Which of the following statements about the sources of DNA used for molecular cloning is correct? Question #1 (A) cdna

More information

Targeted modification of gene function exploiting homology directed repair of TALENmediated double strand breaks in barley

Targeted modification of gene function exploiting homology directed repair of TALENmediated double strand breaks in barley Targeted modification of gene function exploiting homology directed repair of TALENmediated double strand breaks in barley Nagaveni Budhagatapalli a, Twan Rutten b, Maia Gurushidze a, Jochen Kumlehn a,

More information

NAME TA SEC Problem Set 4 FRIDAY October 15, Answers to this problem set must be inserted into the box outside

NAME TA SEC Problem Set 4 FRIDAY October 15, Answers to this problem set must be inserted into the box outside MIT Biology Department 7.012: Introductory Biology - Fall 2004 Instructors: Professor Eric Lander, Professor Robert A. Weinberg, Dr. Claudette Gardel NAME TA SEC 7.012 Problem Set 4 FRIDAY October 15,

More information

Supplementary Figure 1. Comparison of nodules from Gifu and epr3-9 plants inoculated with M. loti MAFF and incubated at 21 C or 28 C.

Supplementary Figure 1. Comparison of nodules from Gifu and epr3-9 plants inoculated with M. loti MAFF and incubated at 21 C or 28 C. Supplementary Figure 1. Comparison of nodules from Gifu and epr3-9 plants inoculated with M. loti MAFF303099 and incubated at 21 C or 28 C. (a to l) are at 21 C, and (m to å) are at 28 C. (a, e, i, m,

More information

Regular Paper. Introduction

Regular Paper. Introduction Evidence that Proliferation of Golgi Apparatus Depends on Both De Novo Generation from the Endoplasmic Reticulum and Formation from Pre-Existing Stacks During the Growth of Tobacco BY-2 Cells Moses Olabiyi

More information

Cargo Proteins Facilitate the Formation of Transport Vesicles in the Cytoplasm to Vacuole Targeting Pathway*

Cargo Proteins Facilitate the Formation of Transport Vesicles in the Cytoplasm to Vacuole Targeting Pathway* THE JOURNAL OF BIOLOGICAL CHEMISTRY Vol. 279, No. 29, Issue of July 16, pp. 29889 29894, 2004 2004 by The American Society for Biochemistry and Molecular Biology, Inc. Printed in U.S.A. Cargo Proteins

More information

sirna Transfection Into Primary Neurons Using Fuse-It-siRNA

sirna Transfection Into Primary Neurons Using Fuse-It-siRNA sirna Transfection Into Primary Neurons Using Fuse-It-siRNA This Application Note describes a protocol for sirna transfection into sensitive, primary cortical neurons using Fuse-It-siRNA. This innovative

More information

Purification of Lactate Dehydrogenase

Purification of Lactate Dehydrogenase Dominican University of California Dominican Scholar Scholarly & Creative Works Conference 2018 Scholarly and Creative Works Conference 2016 Apr 15th, 1:30 PM - 2:00 PM Purification of Lactate Dehydrogenase

More information

Supplementary Figure 1

Supplementary Figure 1 Supplementary Figure 1 Supplementary Figure 1: Vector maps of TRMPV and TRMPVIR variants. Many derivatives of TRMPV have been generated and tested. Unless otherwise noted, experiments in this paper use

More information

Purification of alpha-1 antitrypsin using an antibody based affinity chromatography medium

Purification of alpha-1 antitrypsin using an antibody based affinity chromatography medium Purification of alpha-1 antitrypsin using an antibody based affinity chromatography medium Ulrika Meyer a, Hanna Wlad a, Sven Blokland b, Frank J.M. Detmers b and Henrik Ihre a a GE Healthcare Bio-Sciences

More information

Supplementary Figure 1. Isolation of GFPHigh cells.

Supplementary Figure 1. Isolation of GFPHigh cells. Supplementary Figure 1. Isolation of GFP High cells. (A) Schematic diagram of cell isolation based on Wnt signaling activity. Colorectal cancer (CRC) cell lines were stably transduced with lentivirus encoding

More information

Supplementary material to Alterations in the properties of the cell membrane due to glycosphingolipid accumulation in a model of Gaucher disease

Supplementary material to Alterations in the properties of the cell membrane due to glycosphingolipid accumulation in a model of Gaucher disease Supplementary material to Alterations in the properties of the cell membrane due to glycosphingolipid accumulation in a model of Gaucher disease Gyula Batta, Lilla Soltész, Tamás Kovács, Tamás Bozó, Zoltán

More information

Supplementary Fig. 1

Supplementary Fig. 1 SalI plt52-gfp-tr4-nos mp R Nco I XbaI amhi SmaI amhi TG GG TT G GG T G GGG T GG GT T TG EcoRV SacI HindIII SphI PstI SalI 6pb 725pb 255 pb LT 52 GFP R4 NOS Nco I XbaI amhi SmaI amhi TG GG TT G GG T G

More information

To isolate single GNS 144 cell clones, cells were plated at a density of 1cell/well

To isolate single GNS 144 cell clones, cells were plated at a density of 1cell/well Supplemental Information: Supplemental Methods: Cell culture To isolate single GNS 144 cell clones, cells were plated at a density of 1cell/well in 96 well Primaria plates in GNS media and incubated at

More information

Nature Methods: doi: /nmeth Supplementary Figure 1. Retention of RNA with LabelX.

Nature Methods: doi: /nmeth Supplementary Figure 1. Retention of RNA with LabelX. Supplementary Figure 1 Retention of RNA with LabelX. (a) Epi-fluorescence image of single molecule FISH (smfish) against GAPDH on HeLa cells expanded without LabelX treatment. (b) Epi-fluorescence image

More information

Cationic Vector Intercalation into the Lipid Membrane Enables Intact Polyplex DNA Escape from Endosomes for Gene Delivery

Cationic Vector Intercalation into the Lipid Membrane Enables Intact Polyplex DNA Escape from Endosomes for Gene Delivery Cationic Vector Intercalation into the Lipid Membrane Enables Intact Polyplex DNA Escape from Endosomes for Gene Delivery Sriram Vaidyanathan, 1 Junjie Chen, 2 Bradford G. Orr, 3 Mark M. Banaszak Holl

More information

Notes to accompany the slidecast on theory of SDS PAGE and Western blotting

Notes to accompany the slidecast on theory of SDS PAGE and Western blotting S317 Biological science: from genes to species Notes to accompany the slidecast on theory of SDS PAGE and Western blotting SDS PAGE SDS PAGE is a standard technique for determining the molecular size of

More information

Challenges to measuring intracellular Ca 2+ Calmodulin: nature s Ca 2+ sensor

Challenges to measuring intracellular Ca 2+ Calmodulin: nature s Ca 2+ sensor Calcium Signals in Biological Systems Lecture 3 (2/9/0) Measuring intracellular Ca 2+ signals II: Genetically encoded Ca 2+ sensors Henry M. Colecraft, Ph.D. Challenges to measuring intracellular Ca 2+

More information

A CRISPR/Cas9 Vector System for Tissue-Specific Gene Disruption in Zebrafish

A CRISPR/Cas9 Vector System for Tissue-Specific Gene Disruption in Zebrafish Developmental Cell Supplemental Information A CRISPR/Cas9 Vector System for Tissue-Specific Gene Disruption in Zebrafish Julien Ablain, Ellen M. Durand, Song Yang, Yi Zhou, and Leonard I. Zon % larvae

More information

Supplemental Material to: SRam Sripad, Dongyoung Kim, Raimund Ober, E. Sally Ward

Supplemental Material to: SRam Sripad, Dongyoung Kim, Raimund Ober, E. Sally Ward Landes Bioscience www.landesbioscience.com Supplemental Material to: SRam Sripad, Dongyoung Kim, Raimund Ober, E. Sally Ward The level of HER2 expression is a predictor of antibody- HER2 trafficking behavior

More information

Supplementary information, Figure S1

Supplementary information, Figure S1 Supplementary information, Figure S1 (A) Schematic diagram of the sgrna and hspcas9 expression cassettes in a single binary vector designed for Agrobacterium-mediated stable transformation of Arabidopsis

More information

2D gel Western blotting using antibodies against ubiquitin, SUMO and acetyl PTM

2D gel Western blotting using antibodies against ubiquitin, SUMO and acetyl PTM 2D gel Western blotting using antibodies against ubiquitin, SUMO and acetyl PTM Nancy Kendrick, Jon Johansen & Matt Hoelter, Kendrick Labs Inc www.kendricklabs.com Talk Outline Significance Method description

More information

Thyroid peroxidase gene expression is induced by lipopolysaccharide involving Nuclear Factor (NF)-κB p65 subunit phosphorylation

Thyroid peroxidase gene expression is induced by lipopolysaccharide involving Nuclear Factor (NF)-κB p65 subunit phosphorylation 1 2 3 4 5 SUPPLEMENTAL DATA Thyroid peroxidase gene expression is induced by lipopolysaccharide involving Nuclear Factor (NF)-κB p65 subunit phosphorylation Magalí Nazar, Juan Pablo Nicola, María Laura

More information

GM130 Is Required for Compartmental Organization of Dendritic Golgi Outposts

GM130 Is Required for Compartmental Organization of Dendritic Golgi Outposts Current Biology, Volume 24 Supplemental Information GM130 Is Required for Compartmental Organization of Dendritic Golgi Outposts Wei Zhou, Jin Chang, Xin Wang, Masha G. Savelieff, Yinyin Zhao, Shanshan

More information

Franzens-Universitaet Graz, Humboldtstrasse 50, 8010 Graz. Phone: ++43 (0) Fax: ++43 (0)

Franzens-Universitaet Graz, Humboldtstrasse 50, 8010 Graz. Phone: ++43 (0) Fax: ++43 (0) Extracellular nucleases and extracellular DNA play important roles in Vibrio cholerae biofilm formation Andrea Seper 1, Vera H. I. Fengler 1, Sandro Roier 1, Heimo Wolinski 1, Sepp D. Kohlwein 1, Anne

More information

Electronic Supplementary Information

Electronic Supplementary Information Electronic Supplementary Material (ESI) for Molecular BioSystems. This journal is The Royal Society of Chemistry 2017 Electronic Supplementary Information Dissecting binding of a β-barrel outer membrane

More information

CytoPainter Golgi Staining Kit Green Fluorescence

CytoPainter Golgi Staining Kit Green Fluorescence ab139483 CytoPainter Golgi Staining Kit Green Fluorescence Instructions for Use Designed for the detection of Golgi bodies by microscopy This product is for research use only and is not intended for diagnostic

More information

Amanda H. Caster and Richard A. Kahn 1 From the Department of Biochemistry, Emory University School of Medicine, Atlanta, Georgia 30322

Amanda H. Caster and Richard A. Kahn 1 From the Department of Biochemistry, Emory University School of Medicine, Atlanta, Georgia 30322 THE JOURNAL OF BIOLOGICAL CHEMISTRY VOL. 288, NO. 40, pp. 2867 2880, October 4, 2013 2013 by The American Society for Biochemistry and Molecular Biology, Inc. Published in the U.S.A. Recruitment of the

More information

mcherry Monoclonal Antibody (16D7) Catalog Number M11217 Product data sheet

mcherry Monoclonal Antibody (16D7) Catalog Number M11217 Product data sheet Website: thermofisher.com Customer Service (US): 1 800 955 6288 ext. 1 Technical Support (US): 1 800 955 6288 ext. 441 mcherry Monoclonal Antibody (16D7) Catalog Number M11217 Product data sheet Details

More information

TightRegulation, Modulation, and High-Level Expression byvectors ContainingtheArabinose Promoter

TightRegulation, Modulation, and High-Level Expression byvectors ContainingtheArabinose Promoter TightRegulation, Modulation, and High-Level Expression byvectors ContainingtheArabinose Promoter L M Guzman et al. (1995) Journal of Bacteriology 177: 4121-4130 Outline 1. Introduction 2. Objective 3.

More information

Immunofluorescence images of different core histones and different histone exchange assay.

Immunofluorescence images of different core histones and different histone exchange assay. Molecular Cell, Volume 51 Supplemental Information Enhanced Chromatin Dynamics by FACT Promotes Transcriptional Restart after UV-Induced DNA Damage Christoffel Dinant, Giannis Ampatziadis-Michailidis,

More information

Supplement Figure 1. Characterization of the moab. (A) A series of moabs that are anti-hαiib-specific were tested for their ability to bind to

Supplement Figure 1. Characterization of the moab. (A) A series of moabs that are anti-hαiib-specific were tested for their ability to bind to Supplement Figure 1. Characterization of the 312.8 moab. (A) A series of moabs that are anti-hαiib-specific were tested for their ability to bind to platelets. The black line represents the 312.8 moab

More information

7.06 Problem Set #3, Spring 2005

7.06 Problem Set #3, Spring 2005 7.06 Problem Set #3, Spring 2005 1. The Drosophila compound eye is composed of about 800 units called ommatidia. Each ommatidium contains eight photoreceptor neurons (R1 through R8), which develop in a

More information

AT2G02060 AT2G40260 AT2G AT4G04580 AT2G06020 AT2G AT5G06800 AT3G13040 AT2G AT5G AT3G04030

AT2G02060 AT2G40260 AT2G AT4G04580 AT2G06020 AT2G AT5G06800 AT3G13040 AT2G AT5G AT3G04030 AT5G45580 75 AT3G10760 63 AT5G05090 92 AT2G40970 AT3G46640 LUX/PCL1 66 82 AT5G59570 BOA AT4G18020 PRR2 97 AT2G20570 GLK1 55 47 AT5G44190 GLK2 58 AT1G49560 HHO6 AT4G37180 HHO5 AT2G03500 HHO4 98 45 AT1G13300

More information

Supplemental Information. Stratum, a Homolog of the Human GEF Mss4, Partnered with Rab8, Controls the Basal Restriction

Supplemental Information. Stratum, a Homolog of the Human GEF Mss4, Partnered with Rab8, Controls the Basal Restriction Cell Reports, Volume 18 Supplemental Information Stratum, a Homolog of the Human GEF Mss4, Partnered with Rab8, Controls the Basal Restriction of Basement Membrane Proteins in Epithelial Cells Olivier

More information

Assays for studying mitochondrial health and function

Assays for studying mitochondrial health and function APPLICATION NOTE Fluorescence labeling and detection Assays for studying mitochondrial health and function Introduction Mitochondria play a critical role in maintaining normal cellular activities. Mitochondria

More information

Different Domains of the UBL-UBA Ubiquitin Receptor, Ddi1/Vsm1, Are Involved in Its Multiple Cellular Roles

Different Domains of the UBL-UBA Ubiquitin Receptor, Ddi1/Vsm1, Are Involved in Its Multiple Cellular Roles Molecular Biology of the Cell Vol. 19, 3625 3637, September 2008 Different Domains of the UBL-UBA Ubiquitin Receptor, Ddi1/Vsm1, Are Involved in Its Multiple Cellular Roles Galina Gabriely, Rachel Kama,

More information

Amersham * ECL * Gel horizontal electrophoresis system

Amersham * ECL * Gel horizontal electrophoresis system GE Healthcare Life Sciences Data file 28-9970-20 AB Electrophoresis products Amersham * ECL * Gel horizontal electrophoresis system Amersham ECL Gel and Amersham ECL Gel Box constitute a horizontal mini-gel

More information

Supplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling

Supplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling Supplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling Glendining KA 1, Markie D 2, Gardner RJM 4, Franz EA 3, Robertson SP 4, Jasoni CL 1 Supplementary

More information

SOD1 as a Molecular Switch for Initiating the Homeostatic ER Stress Response under Zinc Deficiency

SOD1 as a Molecular Switch for Initiating the Homeostatic ER Stress Response under Zinc Deficiency Molecular Cell, Volume 52 Supplemental Information SOD1 as a Molecular Switch for Initiating the Homeostatic ER Stress Response under Zinc Deficiency Kengo Homma, Takao Fujisawa, Naomi Tsuburaya, Namiko

More information

ab Hypoxic Response Human Flow Cytometry Kit

ab Hypoxic Response Human Flow Cytometry Kit ab126585 Hypoxic Response Human Flow Cytometry Kit Instructions for Use For measuring protein levels by flow cytometry: hypoxia-inducible factor 1-alpha (HIF1A) and BCL2/adenovirus E1B 19 kda proteininteracting

More information

Mayumi Egawa, Kaori Mukai, Soichiro Yoshikawa, Misako Iki, Naofumi Mukaida, Yohei Kawano, Yoshiyuki Minegishi, and Hajime Karasuyama

Mayumi Egawa, Kaori Mukai, Soichiro Yoshikawa, Misako Iki, Naofumi Mukaida, Yohei Kawano, Yoshiyuki Minegishi, and Hajime Karasuyama Immunity, Volume 38 Supplemental Information Inflammatory Monocytes Recruited to Allergic Skin Acquire an Anti-inflammatory M2 Phenotype via Basophil-Derived Interleukin-4 Mayumi Egawa, Kaori Mukai, Soichiro

More information

SUMOstar Gene Fusion Technology

SUMOstar Gene Fusion Technology Gene Fusion Technology NEW METHODS FOR ENHANCING FUNCTIONAL PROTEIN EXPRESSION AND PURIFICATION IN INSECT CELLS White Paper June 2007 LifeSensors Inc. 271 Great Valley Parkway Malvern, PA 19355 www.lifesensors.com

More information

Contents... vii. List of Figures... xii. List of Tables... xiv. Abbreviatons... xv. Summary... xvii. 1. Introduction In vitro evolution...

Contents... vii. List of Figures... xii. List of Tables... xiv. Abbreviatons... xv. Summary... xvii. 1. Introduction In vitro evolution... vii Contents Contents... vii List of Figures... xii List of Tables... xiv Abbreviatons... xv Summary... xvii 1. Introduction...1 1.1 In vitro evolution... 1 1.2 Phage Display Technology... 3 1.3 Cell surface

More information

Lecture 25 (11/15/17)

Lecture 25 (11/15/17) Lecture 25 (11/15/17) Reading: Ch9; 328-332 Ch25; 990-995, 1005-1012 Problems: Ch9 (study-guide: applying); 1,2 Ch9 (study-guide: facts); 7,8 Ch25 (text); 1-3,5-7,9,10,13-15 Ch25 (study-guide: applying);

More information

Heme utilization in the Caenorhabditis elegans hypodermal cells is facilitated by hemeresponsive

Heme utilization in the Caenorhabditis elegans hypodermal cells is facilitated by hemeresponsive Supplemental Data Heme utilization in the Caenorhabditis elegans hypodermal cells is facilitated by hemeresponsive gene-2 Caiyong Chen 1, Tamika K. Samuel 1, Michael Krause 2, Harry A. Dailey 3, and Iqbal

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION SUPPLEMENTARY INFORMATION Conserved arginines on the rim of Hfq catalyze base pair formation and exchange Subrata Panja and Sarah A. Woodson T.C. Jenkins Department of Biophysics, Johns Hopkins University,

More information

The microtubule-associated tau protein has intrinsic acetyltransferase activity. Todd J. Cohen, Dave Friedmann, Andrew W. Hwang, Ronen Marmorstein and

The microtubule-associated tau protein has intrinsic acetyltransferase activity. Todd J. Cohen, Dave Friedmann, Andrew W. Hwang, Ronen Marmorstein and SUPPLEMENTARY INFORMATION: The microtubule-associated tau protein has intrinsic acetyltransferase activity Todd J. Cohen, Dave Friedmann, Andrew W. Hwang, Ronen Marmorstein and Virginia M.Y. Lee Cohen

More information

Some types of Mutagenesis

Some types of Mutagenesis Mutagenesis What Is a Mutation? Genetic information is encoded by the sequence of the nucleotide bases in DNA of the gene. The four nucleotides are: adenine (A), thymine (T), guanine (G), and cytosine

More information

Biochimie II. Assistants Ben Brankatschk Eleonora Torti

Biochimie II.  Assistants Ben Brankatschk Eleonora Torti Biochimie II Purification de protéines exprimées dans des cellules humaines en culture Daniel Abegg Christophe Berthier Pauline Bonvin abegg6@etu.unige.ch berthie4@etu.unige.ch bonvinp0@etu.unige.ch Assistants

More information

64 CuCl 2 in 50 µl 0.1N NaOAc buffer, and 20 µg of each DOTA-antibody conjugate in 40 µl

64 CuCl 2 in 50 µl 0.1N NaOAc buffer, and 20 µg of each DOTA-antibody conjugate in 40 µl Number of DOTA per antibody The average number of DOTA chelators per antibody was measured using a reported procedure with modifications (1,2). Briefly, nonradioactive CuCl 2 (80-fold excess of DOTA antibodies)

More information

Stabilization of a virus-like particle and its application as a nanoreactor at physiological conditions

Stabilization of a virus-like particle and its application as a nanoreactor at physiological conditions Supporting Information Stabilization of a virus-like particle and its application as a nanoreactor at physiological conditions Lise Schoonen, b Sjors Maassen, b Roeland J. M. Nolte b and Jan C. M. van

More information

CBI Toolbox Tour 2015

CBI Toolbox Tour 2015 CBI Toolbox Tour 2015 Thermophoresis (NanoTemper) NT.115 & NT.LabelFree Images: NanoTemper Circular Dichroism Jasco J-1500 Spectrometer Six Position Turreted Peltier Temperature Control System Automated

More information

Targeting of a Nicotiana plumbaginifolia H 1 -ATPase to the Plasma Membrane Is Not by Default and Requires Cytosolic Structural Determinants

Targeting of a Nicotiana plumbaginifolia H 1 -ATPase to the Plasma Membrane Is Not by Default and Requires Cytosolic Structural Determinants The Plant Cell, Vol. 16, 1772 1789, July 2004, www.plantcell.org ª 2004 American Society of Plant Biologists Targeting of a Nicotiana plumbaginifolia H 1 -ATPase to the Plasma Membrane Is Not by Default

More information

Nature Neuroscience: doi: /nn Supplementary Figure 1

Nature Neuroscience: doi: /nn Supplementary Figure 1 Supplementary Figure 1 PCR-genotyping of the three mouse models used in this study and controls for behavioral experiments after semi-chronic Pten inhibition. a-c. DNA from App/Psen1 (a), Pten tg (b) and

More information

Figure S1. MUT-16 localization in L4 hermaphrodite, adult hermaphrodite, and adult male germlines. MUT-16 DAPI. Phillips et al. S-1. male.

Figure S1. MUT-16 localization in L4 hermaphrodite, adult hermaphrodite, and adult male germlines. MUT-16 DAPI. Phillips et al. S-1. male. Supplementary Material for Phillips et al. Figure S1. MUT-16 localization in L4 hermaphrodite, adult hermaphrodite, and adult male germlines. Figure S2. Mutator foci and P granules localize independently

More information

OPTICAL CONTROL OF TUMOR INDUCTION IN THE ZEBRAFISH

OPTICAL CONTROL OF TUMOR INDUCTION IN THE ZEBRAFISH OPTICAL CONTROL OF TUMOR INDUCTION IN THE ZEBRAFISH Zhiping Feng, 1,12 Suzy Nam, 2 Fatima Hamouri, 3,4 Isabelle Aujard, 5,6 Bertrand Ducos, 3,4 Sophie Vriz, 7,8 Michel Volovitch, 7,9 Ludovic Jullien, 5,6

More information

UNIVERSITY OF CAMBRIDGE INTERNATIONAL EXAMINATIONS General Certificate of Education Advanced Level

UNIVERSITY OF CAMBRIDGE INTERNATIONAL EXAMINATIONS General Certificate of Education Advanced Level UNIVERSITY OF CAMBRIDGE INTERNATIONAL EXAMINATIONS General Certificate of Education Advanced Level *1053462426* BIOLOGY 9700/43 Paper 4 Structured Questions A2 October/November 2010 2 hours Candidates

More information

Multiplex Fluorescence Assays for Adherence Cells without Trypsinization

Multiplex Fluorescence Assays for Adherence Cells without Trypsinization Multiplex Fluorescence Assays for Adherence Cells without Trypsinization The combination of a bright field and three fluorescent channels allows the Celigo to perform many multiplexed assays. A gating

More information

Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 29 September 2005

Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 29 September 2005 Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 9 September 005 Focus concept Purification of a novel seed storage protein allows sequence analysis and

More information

Fig. S1. Nature Medicine: doi: /nm HoxA9 expression levels BM MOZ-TIF2 AML BM. Sca-1-H. c-kit-h CSF1R-H CD16/32-H. Mac1-H.

Fig. S1. Nature Medicine: doi: /nm HoxA9 expression levels BM MOZ-TIF2 AML BM. Sca-1-H. c-kit-h CSF1R-H CD16/32-H. Mac1-H. A 1 4 1 4 1 4 CSF1RH 1 3 1 2 1 1 CSF1RH 1 3 1 2 1 1 CSF1RH 1 3 1 2 1 1 1 1 1 1 1 2 1 3 1 4 GFPH 1 1 1 1 1 2 1 3 1 4 Sca1H 1 1 1 1 1 2 1 3 1 4 ckith 1 4 1 4 1 4 CSF1RH 1 3 1 2 1 1 CSF1RH 1 3 1 2 1 1 CSF1RH

More information

BINF 6010 ITSC 8010 Spring 2010 Biotechnology & Genomics Lab Experimental Design- Technical.

BINF 6010 ITSC 8010 Spring 2010 Biotechnology & Genomics Lab Experimental Design- Technical. BINF 6010 ITSC 8010 Spring 2010 Biotechnology & Genomics Lab Experimental Design- Technical http://webpages.uncc.edu/~jweller2 Topics Experimental Design - sources of technical variation Library construction

More information

qpcr Quantitative PCR or Real-time PCR Gives a measurement of PCR product at end of each cycle real time

qpcr Quantitative PCR or Real-time PCR Gives a measurement of PCR product at end of each cycle real time qpcr qpcr Quantitative PCR or Real-time PCR Gives a measurement of PCR product at end of each cycle real time Differs from endpoint PCR gel on last cycle Used to determines relative amount of template

More information

CHAPTER 9 DNA Technologies

CHAPTER 9 DNA Technologies CHAPTER 9 DNA Technologies Recombinant DNA Artificially created DNA that combines sequences that do not occur together in the nature Basis of much of the modern molecular biology Molecular cloning of genes

More information

AccuPower PCR PreMix 73. AccuPower Taq PCR PreMix 77. AccuPower PCR PreMix (with UDG) 79. AccuPower HotStart PCR PreMix 81

AccuPower PCR PreMix 73. AccuPower Taq PCR PreMix 77. AccuPower PCR PreMix (with UDG) 79. AccuPower HotStart PCR PreMix 81 PCR PreMix 73 AccuPower Taq PCR PreMix 77 AccuPower PCR PreMix (with UDG) 79 AccuPower HotStart PCR PreMix 81 AccuPower PyroHotStart Taq PCR PreMix 84 AccuPower HotStart PCR PreMix (with UDG) 87 AccuPower

More information

Supplemental Data. mir156-regulated SPL Transcription. Factors Define an Endogenous Flowering. Pathway in Arabidopsis thaliana

Supplemental Data. mir156-regulated SPL Transcription. Factors Define an Endogenous Flowering. Pathway in Arabidopsis thaliana Cell, Volume 138 Supplemental Data mir156-regulated SPL Transcription Factors Define an Endogenous Flowering Pathway in Arabidopsis thaliana Jia-Wei Wang, Benjamin Czech, and Detlef Weigel Table S1. Interaction

More information

Spectral Separation of Multifluorescence Labels with the LSM 510 META

Spectral Separation of Multifluorescence Labels with the LSM 510 META Microscopy from Carl Zeiss Spectral Separation of Multifluorescence Labels with the LSM 510 META Indians living in the South American rain forest can distinguish between almost 200 hues of green in their

More information

Figure S2. Response of mouse ES cells to GSK3 inhibition. Mentioned in discussion

Figure S2. Response of mouse ES cells to GSK3 inhibition. Mentioned in discussion Stem Cell Reports, Volume 1 Supplemental Information Robust Self-Renewal of Rat Embryonic Stem Cells Requires Fine-Tuning of Glycogen Synthase Kinase-3 Inhibition Yaoyao Chen, Kathryn Blair, and Austin

More information

TECHNICAL BULLETIN. In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits

TECHNICAL BULLETIN. In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits Catalog Numbers APPA001 In Vitro Bacterial Split GFP "Fold 'n' Glow" Solubility Assay Kit (Green) APPA008 In Vitro Bacterial

More information

Supplementary Materials: Viral Protein Kinetics of Piscine Orthoreovirus Infection in Atlantic Salmon Blood Cells

Supplementary Materials: Viral Protein Kinetics of Piscine Orthoreovirus Infection in Atlantic Salmon Blood Cells S1of S7 Supplementary Materials: Viral Protein Kinetics of Piscine Orthoreovirus Infection in Atlantic Salmon Blood Cells Hanne Merethe Haatveit, Øystein Wessel, Turhan Markussen, Morten Lund, Bernd Thiede,

More information

Supplemental Fig. S1. Key to underlines: Key to amino acids:

Supplemental Fig. S1. Key to underlines: Key to amino acids: AspA-F1 AspA 1 MKQMETKGYGYFRKTKAYGLVCGIT--------------LAGALTLGTTSVSADDVTTLNPATNLTTLQTPPTADQTQLAHQAGQQSGELVSEVSNTEWD 86 SspB 1 MQKREV--FG-FRKSKVAKTLCGAV-LGAALIAIADQQVLADEVTETNSTANVAVTTTGNPATNLPEAQGEATEAASQSQAQAGSKDGALPVEVSADDLN

More information

Nature Structural and Molecular Biology: doi: /nsmb.2937

Nature Structural and Molecular Biology: doi: /nsmb.2937 Supplementary Figure 1 Multiple sequence alignment of the CtIP N-terminal domain, purified CtIP protein constructs and details of the 2F o F c electron density map of CtIP-NTD. (a) Multiple sequence alignment,

More information

Automated Imaging and Dual-Mask Analysis of γh2ax Foci to Determine DNA Damage on an Individual Cell Basis

Automated Imaging and Dual-Mask Analysis of γh2ax Foci to Determine DNA Damage on an Individual Cell Basis A p p l i c a t i o n N o t e Automated Imaging and Dual-Mask Analysis of γh2ax Foci to Determine DNA Damage on an Individual Cell Basis Brad Larson, BioTek Instruments, Inc., Winooski, VT USA Asha Sinha

More information

Calcium-dependent modulation and plasma membrane targeting of the AKT2 potassium channel by the CBL4/ CIPK6 calcium sensor/protein kinase complex

Calcium-dependent modulation and plasma membrane targeting of the AKT2 potassium channel by the CBL4/ CIPK6 calcium sensor/protein kinase complex 1116 ORIGINAL ARTICLE Cell Research (2011) 21:1116-1130. 2011 IBCB, SIBS, CAS All rights reserved 1001-0602/11 $ 32.00 www.nature.com/cr npg Calcium-dependent modulation and plasma membrane targeting of

More information

Nature Immunology: doi: /ni Supplementary Figure 1

Nature Immunology: doi: /ni Supplementary Figure 1 Supplementary Figure 1 BALB/c LYVE1-deficient mice exhibited reduced lymphatic trafficking of all DC subsets after oxazolone-induced sensitization. (a) Schematic overview of the mouse skin oxazolone contact

More information

Immunofluorescence Staining Protocol for 3 Well Chamber, removable

Immunofluorescence Staining Protocol for 3 Well Chamber, removable Immunofluorescence Staining Protocol for 3 Well Chamber, removable This Application Note presents a simple protocol for the cultivation, fixation, and staining of cells using the 3 Well Chamber, removable.

More information

Technical Note. Housekeeping Protein Validation Protocol

Technical Note. Housekeeping Protein Validation Protocol Technical Note Housekeeping Protein Validation Protocol Published March 2017. The most recent version of this Technical Note is posted at licor.com/bio/support. Visit us on protocols.io! Explore an interactive

More information

Supplementary Data: Fig. 1S Detailed description of In vivo experimental design

Supplementary Data: Fig. 1S Detailed description of In vivo experimental design 1 2 Supplementary Data: Fig. 1S Detailed description of In vivo experimental design 3 4 5 6 7 8 9 Relative Expression Studies 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 The

More information

Supplemental Data. Regulating Gene Expression. through RNA Nuclear Retention

Supplemental Data. Regulating Gene Expression. through RNA Nuclear Retention Supplemental Data Regulating Gene Expression through RNA Nuclear Retention Kannanganattu V. Prasanth, Supriya G. Prasanth, Zhenyu Xuan, Stephen Hearn, Susan M. Freier, C. Frank Bennett, Michael Q. Zhang,

More information