PHT1;2-CFP YFP-PHF + PHT1;2-CFP YFP-PHF
|
|
- Allen Sparks
- 6 years ago
- Views:
Transcription
1 YFP-PHF1 CFP-PHT1;2 PHT1;2-CFP YFP-PHF + PHT1;2-CFP YFP-PHF + CFP-PHT1;2 Negative control!-gfp Supplemental Figure 1: PHT1;2 accumulation is PHF1 dependent. Immunoblot analysis on total protein extract corresponding to transient expression in N. benthamiana leaf epidermis 48h postinfiltration presented in figure 2. Protein detection is done using anti-gfp antibodies recognizing YFP-PHF1 (75kDa dark arrow) or CFP-PHT1;2 fusion proteins (90kDa white arrow). Coomassie blue acrylamide gel staining is shown as protein loading control. 1
2 PHF1-GFP ST-mRFP Merging D E F BFA 50!M 120min PHF1-GFP ST-mRFP Merging Supplemental Figure 2: Strict ER localization of PHF1. (A-F) A. thaliana epidermal root cells expressing PHF1-GFP under control of its own promoter (A) and Golgi marker ST-mRFP (B). (C-D) same line with BFA treatment (50!M, 2 hours). Scale bar:10!m. 2
3 YFP-channel Supplemental Figure 3: PHT1;2-CFP export from ER is COPII-dependent (A-L) Transient protein expression in N. benthamiana epidermal cells analyzed by confocal microscopy 48h post-infiltration. Transient expression of PHT1;2-CFP alone (B) showing weak plasma membrane fluorescence, together with Sec12-YFP (D-I) blue fluorescence is retained in ER structure with Sec12-YFP. Co-expression of PHT1;2-CFP together with YFP-PHF1 (J-L) shows an increase of blue fluorescence, colocalization at the ER and correct targeting of PHT1;2-CFP to the plasma membrane. Scale bars are 10µm. 3
4 Supplemental Figure 4: PHF1 is not associated with recruitment of COPII components to ERES. (A-L) Transient protein expression in N. benthamiana epidermal cells analyzed by confocal microscopy 48h post-infiltration. Transient expression ERES marker YFP-Sec24 expressed alone (B), or together with ST-CFP (G-I), PHT1;2-CFP (J- L) or CFP-PHF1 (J-L). YFP-Sec24 mainly localizes to cytoplasm and is recruited to ERES (white arrows). Scale bars are 10µm. 4
5 CFP-channel Sar1-YFP Merging CFP-PHF1 Sar1-YFP Merging G H I PHT1;2-CFP YFP-channel Merging J K L PHT1;2-CFP Sar1-YFP Merging Supplemental Figure 5: Co-expression of PHF1 and PHT1;2-CFP fusion protein together with ERES marker SAR1. (A-L) Transient protein expression in N. benthamiana epidermal cells analyzed by confocal microscopy 48h post-infiltrations. Transient expression of SAR1-YFP alone (B) or together with CFP-PHF1 (D-F) or PHT1;2-CFP (J-L). Transient expression PHT1;2-CFP alone is indicated as control (G-I) Scale bars = 10!M. 5
6 Supplemental Figure 6: MS/MS fragmentation spectrum of the diphosphopeptide SLEEL(pS)GEAEV(pS)HDEK (PHT1.1). Attributed y and b ions are indicated on the spectrum. Double Neutral Loss (NL) was present. S*: identified phosphorylated serine after neutral loss. 6
7 Control treatment M Control treatment PHT1;1-GFP 0!M Pi 500!M Pi N r =0,51±0,09 r = 0,53 SNX1-mRFP PHT1;1-GFP r = 0,55 SNX1-mRFP 0!M Pi 500!M Pi r r =0,0±0,034 r =0,53±0,09 r r =0,0±0,05 Supplemental Figure 7: Sorting endosomes localization of PHT1;1 independently of Pi external content. A. thaliana root tip cells co-expressing PHT1;1- GFP and the sorting endosome marker SNX1- mrfp, 60 minutes after 33!M Wm treatment. Plants were cultivated on Pi depleted medium (A-F) or Pi (500!M) containing medium (G-L) prior to treatment. (M) Quantitative analysis of intracellular colocalization between PHT1;1-GFP and SNXmRFP, cytofluorogram obtain for two images, (N) average Pearson s coefficient (r) and after Coste randomization based colocalization (r r ) are given. Scale bars = 5!M. The Pearson s coefficient was calculated based on the analysis of 350 root tip cells from 20 plants per condition. 7
8 A CHX 50!M T0 B T2 C T7 Control treatment D T7 -P E T0 F T2 G T7 H T7 +P Supplemental Figure 8: Kinetic analysis of Pi-induced PHT1 degradation. A. thaliana root tip cells co-expressing PHT1;1-GFP cultivated on medium containing 0!M (A-D) Pi or 500!M (E-H). (A and E) prior to drug treatment; (B and F) 2 hours and (C and G) 7 hours after CHX (50!M) treatment. (H and L) control untreated after 7 hours. Scale bars are 10!m 8
9 A relative fluorescence (AU) Inhibition 26S proteasome test P500 B relative fluorescence T0 2h CHX 6h MG132 2h CHX Effect of pho2-1 mutation on PHT1;1:GFP degradation P500 T0 2h CHX 0 PHT1;1 pho2 N 1 pho2 N 2 Supplemental Figure 9: Pi induced PHT1 degradation is not affected by MG-132 treatment or pho2-1 mutation. Relative fluorescence intensity of PHT1;1-GFP observed in root of plant grown on +Pi (500!M). (A) Effect of MG132 treatment (6h, 50!M), CHX was added during the two last hours (50!M). (B) Effect of pho2-1 mutation, PHT1;1-GFP marker was introgressed into pho2-1 mutant and treated with CHX drugs as previously described. For each experiment, 12 lateral roots were observed. The fluorescence from 20 (A) or 25 (B) regions of interests for each sample was quantified. The mean and standard deviation from the measurements are indicated here for one of the experiments performed. 9
10 A T0 B T15min C T60min 0!M Pi 500!M Pi D T0 E T15min F T60min Supplemental Figure 10 : Phosphate starvation does not affect internalization of endocytic tracer FM4-64 in root cells. Seedlings cultivatedeither in 500!M Pi (A to C) or Pi deprived (D to F) medium were subjected to kinetic analysis of FM4-64 internalization. Short time (A, B, D and E) shows endocytic tracer at the plasma membrane and endosomes, longer time shows tonoplast staining (C and F). Scale bar=5!m 10
11 Table 1 : Primers used for amplification and site-directed mutagenesis of PHT1;1 forward primer reverse primer PHT1;1 cdna 5'-CACCATGGCCGAACAACAACTAGG-3' 5'-TTTCTCGTCATGGCTAACCTCA-3' PHT1;1-S148A 5'-GTGACTACCCACTTGCTGCCACCATCATGTC-3' 5'-GACATGATGGTGGCAGCAAGTGGGTAGTCAC-3' PHT1;1-S148D 5'-GTGACTACCCACTTGATGCCACCATCATGTC-3' 5'-GACATGATGGTGGCATCAAGTGGGTAGTCAC-3' PHT1;1-S153A 5'-TGCCACCATCATGGCTGAATACGCAAACA-3' 5'-TGTTTGCGTATTCAGCCATGATGGTGGCA-3' PHT1;1-S153D 5'-TGCCACCATCATGGATGAATACGCAAACA-3' 5'-TGTTTGCGTATTCATCCATGATGGTGGCA-3' PHT1;1-T160A 5'-CGCAAACAAGAAGGCCCGTGGGGCTTTCA-3' 5'-TGAAAGCCCCACGGGCCTTCTTGTTTGCG-3' PHT1;1-T160D 5'-CGCAAACAAGAAGGACCGTGGGGCTTTCA-3' 5'-TGAAAGCCCCACGGTCCTTCTTGTTTGCG-3' PHT1;1-T239A 5'-GAAGATGCCTGAAGCTGCCCGTTACACCG-3' 5'-CGGTGTAACGGGCAGCTTCAGGCATCTTC-3' PHT1;1-T239D 5'-GAAGATGCCTGAAGATGCCCGTTACACCG-3' 5'-CGGTGTAACGGGCATCTTCAGGCATCTTC-3' PHT1;1-T368A 5'-GCGTTTATTGATGCCATTGGAAGGTTT-3' 5'-AAACCTTCCAATGGCATCAATAAACGC-3' PHT1;1-T368D 5'-GCGTTTATTGATGACATTGGAAGGTTT-3' 5'-AAACCTTCCAATGTCATCAATAAACGC-3' PHT1;1-S438A 5'-GGCCAGGCTAAGGGCTACATGTCATGGAA-3' 5'-TTCCATGACATGTAGCCCTTAGCCTGGCC-3' PHT1;1-S438D 5'-GGCCAGGCTAAGGGATACATGTCATGGAA-3' 5'-TTCCATGACATGTATCCCTTAGCCTGGCC-3' PHT1;1-S509A 5'-GCCCAAAGGCAAGGCCCTTGAAGAACTCT-3' 5'-AGAGTTCTTCAAGGGCCTTGCCTTTGGGC-3' PHT1;1-S509D 5'-GCCCAAAGGCAAGGACCTTGAAGAACTCT-3' 5'-AGAGTTCTTCAAGGTCCTTGCCTTTGGGC-3' PHT1;1-S514A 5'-CCTTGAAGAACTCGCTGGTGAGGCTGAGG-3' 5'-CCTCAGCCTCACCAGCGAGTTCTTCAAGG-3' PHT1;1-S514D 5'-CCTTGAAGAACTCGATGGTGAGGCTGAGG-3' 5'-CCTCAGCCTCACCATCGAGTTCTTCAAGG-3' PHT1;1-S520A 5'-TGAGGCTGAGGTTGCCCATGACGAGAAA-3' 5'-TTTCTCGTCATGGGCAACCTCAGCCTCA-3' PHT1;1-S520D 5'-TGAGGCTGAGGTTGACCATGACGAGAAA-3' 5'-TTTCTCGTCATGGTCAACCTCAGCCTCA-3' The CACC sequence allowing a directional cloning of PHT1;1 cdna into pentr is shown in bold. For site-directed mutagenesis, the subsitution sites for Ser and Thr in the primers to generate the mutations are underlined. 11
Supplemental Figure 1. Mutation in NLA Causes Increased Pi Uptake Activity and
Supplemental Figure 1. Mutation in NLA Causes Increased Pi Uptake Activity and PHT1 Protein Amounts. (A) Shoot morphology of 19-day-old nla mutants under Pi-sufficient conditions. (B) [ 33 P]Pi uptake
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION Legends for Supplementary Tables. Supplementary Table 1. An excel file containing primary screen data. Worksheet 1, Normalized quantification data from a duplicated screen: valid
More informationTransport of Potato Lipoxygenase into the Vacuole Larsen, Mia Kruse Guldstrand; Welinder, Karen Gjesing; Jørgensen, Malene
Aalborg Universitet Transport of Potato Lipoxygenase into the Vacuole Larsen, Mia Kruse Guldstrand; Welinder, Karen Gjesing; Jørgensen, Malene Publication date: 2009 Document Version Publisher's PDF, also
More informationa. Primers were purchased from Display Systems Biotech and are listed numerically to differentiate them
Table 2-1. Random upstream primers used in fluorescence differential display. Upstream primer a Sequence 1 5 GATCATAGCC 2 5 CTGCTTGATG 3 5 GATCCAGTAC 4 5 GATCGCATTG 5 5 AAACTCCGTC 6 5 TGGTAAAGGG 7 5 GATCATGGTC
More informationA 5 P degradation hot spot influences molecular farming of anticancerogenic nuclease TBN1 in tobacco cells
Plant Cell, Tissue and Organ Culture (PCTOC) A 5 P degradation hot spot influences molecular farming of anticancerogenic nuclease TBN1 in tobacco cells Anna Týcová a,b, Rajen J. J. Piernikarczyk c, Michael
More informationMOK. Media Optimization Kit
MOK Media Optimization Kit The Media Optimization Kit determines the best medium formulation for maximizing accumulation of recombinant proteins expressed in E. coli, utilizing a series of Athena s superior
More information7.17: Writing Up Results and Creating Illustrations
7.17: Writing Up Results and Creating Illustrations A Results Exercise: Kansas and Pancakes Write a 5-sentence paragraph describing the results illustrated in this figure: - Describe the figure: highlights?
More informationThe Human Protein PRR14 Tethers Heterochromatin to the Nuclear Lamina During Interphase and Mitotic Exit
Cell Reports, Volume 5 Supplemental Information The Human Protein PRR14 Tethers Heterochromatin to the Nuclear Lamina During Interphase and Mitotic Exit Andrey Poleshko, Katelyn M. Mansfield, Caroline
More informationFigure S1. Figure S2. Figure S3 HB Anti-FSP27 (COOH-terminal peptide) Ab. Anti-GST-FSP27(45-127) Ab.
/ 36B4 mrna ratio Figure S1 * 2. 1.6 1.2.8 *.4 control TNFα BRL49653 Figure S2 Su bw AT p iw Anti- (COOH-terminal peptide) Ab Blot : Anti-GST-(45-127) Ab β-actin Figure S3 HB2 HW AT BA T Figure S4 A TAG
More informationover time using live cell microscopy. The time post infection is indicated in the lower left corner.
Title of file for HTML: Supplementary Information Description: Supplementary Figures and Supplementary Table Title of file for HTML: Supplementary Movie 1 Description: Fusion of NBs. BSR cells were infected
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION Dynamic Phosphorylation of HP1 Regulates Mitotic Progression in Human Cells Supplementary Figures Supplementary Figure 1. NDR1 interacts with HP1. (a) Immunoprecipitation using
More informationA subclass of HSP70s regulate development and abiotic stress responses in Arabidopsis thaliana
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 Journal of Plant Research A subclass of HSP70s regulate development and abiotic stress responses in Arabidopsis thaliana Linna Leng 1 Qianqian Liang
More informationConfocal immunofluorescence microscopy
Confocal immunofluorescence microscopy HL-6 and cells were cultured and cytospun onto glass slides. The cells were double immunofluorescence stained for Mt NPM1 and fibrillarin (nucleolar marker). Briefly,
More informationSupplementary Table 1. The Q-PCR primer sequence is summarized in the following table.
Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table. Name Sequence (5-3 ) Application Flag-u ggactacaaggacgacgatgac Shared upstream primer for all the amplifications of
More informationSupplemental Information. Boundary Formation through a Direct. Threshold-Based Readout. of Mobile Small RNA Gradients
Developmental Cell, Volume 43 Supplemental Information Boundary Formation through a Direct Threshold-Based Readout of Mobile Small RNA Gradients Damianos S. Skopelitis, Anna H. Benkovics, Aman Y. Husbands,
More informationSupplementary Figure 1 qrt-pcr expression analysis of NLP8 with and without KNO 3 during germination.
Supplementary Figure 1 qrt-pcr expression analysis of NLP8 with and without KNO 3 during germination. Seeds of Col-0 were harvested from plants grown at 16 C, stored for 2 months, imbibed for indicated
More informationMIT Department of Biology 7.013: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr.
MIT Department of Biology 7.01: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr. Claudette Gardel iv) Would Xba I be useful for cloning? Why or why not?
More informationAlternative Cleavage and Polyadenylation of RNA
Developmental Cell 18 Supplemental Information The Spen Family Protein FPA Controls Alternative Cleavage and Polyadenylation of RNA Csaba Hornyik, Lionel C. Terzi, and Gordon G. Simpson Figure S1, related
More informationThe Conserved Isoleucine Valine Phenylalanine Motif Couples Activation State and Endocytic Functions of b-arrestins
Traffic 2007 Blackwell Munksgaard # 2007 The Authors doi: 10.1111/j.1600-0854.2007.00578.x The Conserved Isoleucine Valine Phenylalanine Motif Couples Activation State and Endocytic Functions of b-arrestins
More informationSupplemental Movie Legend.
Supplemental Movie Legend. Transfected T cells were dropped onto SEE superantigen-pulsed Raji B cells (approximate location indicated by circle). Maximum-intensity projections from Z-stacks (17 slices,
More informationMolecular Cell Biology - Problem Drill 11: Recombinant DNA
Molecular Cell Biology - Problem Drill 11: Recombinant DNA Question No. 1 of 10 1. Which of the following statements about the sources of DNA used for molecular cloning is correct? Question #1 (A) cdna
More informationTargeted modification of gene function exploiting homology directed repair of TALENmediated double strand breaks in barley
Targeted modification of gene function exploiting homology directed repair of TALENmediated double strand breaks in barley Nagaveni Budhagatapalli a, Twan Rutten b, Maia Gurushidze a, Jochen Kumlehn a,
More informationNAME TA SEC Problem Set 4 FRIDAY October 15, Answers to this problem set must be inserted into the box outside
MIT Biology Department 7.012: Introductory Biology - Fall 2004 Instructors: Professor Eric Lander, Professor Robert A. Weinberg, Dr. Claudette Gardel NAME TA SEC 7.012 Problem Set 4 FRIDAY October 15,
More informationSupplementary Figure 1. Comparison of nodules from Gifu and epr3-9 plants inoculated with M. loti MAFF and incubated at 21 C or 28 C.
Supplementary Figure 1. Comparison of nodules from Gifu and epr3-9 plants inoculated with M. loti MAFF303099 and incubated at 21 C or 28 C. (a to l) are at 21 C, and (m to å) are at 28 C. (a, e, i, m,
More informationRegular Paper. Introduction
Evidence that Proliferation of Golgi Apparatus Depends on Both De Novo Generation from the Endoplasmic Reticulum and Formation from Pre-Existing Stacks During the Growth of Tobacco BY-2 Cells Moses Olabiyi
More informationCargo Proteins Facilitate the Formation of Transport Vesicles in the Cytoplasm to Vacuole Targeting Pathway*
THE JOURNAL OF BIOLOGICAL CHEMISTRY Vol. 279, No. 29, Issue of July 16, pp. 29889 29894, 2004 2004 by The American Society for Biochemistry and Molecular Biology, Inc. Printed in U.S.A. Cargo Proteins
More informationsirna Transfection Into Primary Neurons Using Fuse-It-siRNA
sirna Transfection Into Primary Neurons Using Fuse-It-siRNA This Application Note describes a protocol for sirna transfection into sensitive, primary cortical neurons using Fuse-It-siRNA. This innovative
More informationPurification of Lactate Dehydrogenase
Dominican University of California Dominican Scholar Scholarly & Creative Works Conference 2018 Scholarly and Creative Works Conference 2016 Apr 15th, 1:30 PM - 2:00 PM Purification of Lactate Dehydrogenase
More informationSupplementary Figure 1
Supplementary Figure 1 Supplementary Figure 1: Vector maps of TRMPV and TRMPVIR variants. Many derivatives of TRMPV have been generated and tested. Unless otherwise noted, experiments in this paper use
More informationPurification of alpha-1 antitrypsin using an antibody based affinity chromatography medium
Purification of alpha-1 antitrypsin using an antibody based affinity chromatography medium Ulrika Meyer a, Hanna Wlad a, Sven Blokland b, Frank J.M. Detmers b and Henrik Ihre a a GE Healthcare Bio-Sciences
More informationSupplementary Figure 1. Isolation of GFPHigh cells.
Supplementary Figure 1. Isolation of GFP High cells. (A) Schematic diagram of cell isolation based on Wnt signaling activity. Colorectal cancer (CRC) cell lines were stably transduced with lentivirus encoding
More informationSupplementary material to Alterations in the properties of the cell membrane due to glycosphingolipid accumulation in a model of Gaucher disease
Supplementary material to Alterations in the properties of the cell membrane due to glycosphingolipid accumulation in a model of Gaucher disease Gyula Batta, Lilla Soltész, Tamás Kovács, Tamás Bozó, Zoltán
More informationSupplementary Fig. 1
SalI plt52-gfp-tr4-nos mp R Nco I XbaI amhi SmaI amhi TG GG TT G GG T G GGG T GG GT T TG EcoRV SacI HindIII SphI PstI SalI 6pb 725pb 255 pb LT 52 GFP R4 NOS Nco I XbaI amhi SmaI amhi TG GG TT G GG T G
More informationTo isolate single GNS 144 cell clones, cells were plated at a density of 1cell/well
Supplemental Information: Supplemental Methods: Cell culture To isolate single GNS 144 cell clones, cells were plated at a density of 1cell/well in 96 well Primaria plates in GNS media and incubated at
More informationNature Methods: doi: /nmeth Supplementary Figure 1. Retention of RNA with LabelX.
Supplementary Figure 1 Retention of RNA with LabelX. (a) Epi-fluorescence image of single molecule FISH (smfish) against GAPDH on HeLa cells expanded without LabelX treatment. (b) Epi-fluorescence image
More informationCationic Vector Intercalation into the Lipid Membrane Enables Intact Polyplex DNA Escape from Endosomes for Gene Delivery
Cationic Vector Intercalation into the Lipid Membrane Enables Intact Polyplex DNA Escape from Endosomes for Gene Delivery Sriram Vaidyanathan, 1 Junjie Chen, 2 Bradford G. Orr, 3 Mark M. Banaszak Holl
More informationNotes to accompany the slidecast on theory of SDS PAGE and Western blotting
S317 Biological science: from genes to species Notes to accompany the slidecast on theory of SDS PAGE and Western blotting SDS PAGE SDS PAGE is a standard technique for determining the molecular size of
More informationChallenges to measuring intracellular Ca 2+ Calmodulin: nature s Ca 2+ sensor
Calcium Signals in Biological Systems Lecture 3 (2/9/0) Measuring intracellular Ca 2+ signals II: Genetically encoded Ca 2+ sensors Henry M. Colecraft, Ph.D. Challenges to measuring intracellular Ca 2+
More informationA CRISPR/Cas9 Vector System for Tissue-Specific Gene Disruption in Zebrafish
Developmental Cell Supplemental Information A CRISPR/Cas9 Vector System for Tissue-Specific Gene Disruption in Zebrafish Julien Ablain, Ellen M. Durand, Song Yang, Yi Zhou, and Leonard I. Zon % larvae
More informationSupplemental Material to: SRam Sripad, Dongyoung Kim, Raimund Ober, E. Sally Ward
Landes Bioscience www.landesbioscience.com Supplemental Material to: SRam Sripad, Dongyoung Kim, Raimund Ober, E. Sally Ward The level of HER2 expression is a predictor of antibody- HER2 trafficking behavior
More informationSupplementary information, Figure S1
Supplementary information, Figure S1 (A) Schematic diagram of the sgrna and hspcas9 expression cassettes in a single binary vector designed for Agrobacterium-mediated stable transformation of Arabidopsis
More information2D gel Western blotting using antibodies against ubiquitin, SUMO and acetyl PTM
2D gel Western blotting using antibodies against ubiquitin, SUMO and acetyl PTM Nancy Kendrick, Jon Johansen & Matt Hoelter, Kendrick Labs Inc www.kendricklabs.com Talk Outline Significance Method description
More informationThyroid peroxidase gene expression is induced by lipopolysaccharide involving Nuclear Factor (NF)-κB p65 subunit phosphorylation
1 2 3 4 5 SUPPLEMENTAL DATA Thyroid peroxidase gene expression is induced by lipopolysaccharide involving Nuclear Factor (NF)-κB p65 subunit phosphorylation Magalí Nazar, Juan Pablo Nicola, María Laura
More informationGM130 Is Required for Compartmental Organization of Dendritic Golgi Outposts
Current Biology, Volume 24 Supplemental Information GM130 Is Required for Compartmental Organization of Dendritic Golgi Outposts Wei Zhou, Jin Chang, Xin Wang, Masha G. Savelieff, Yinyin Zhao, Shanshan
More informationFranzens-Universitaet Graz, Humboldtstrasse 50, 8010 Graz. Phone: ++43 (0) Fax: ++43 (0)
Extracellular nucleases and extracellular DNA play important roles in Vibrio cholerae biofilm formation Andrea Seper 1, Vera H. I. Fengler 1, Sandro Roier 1, Heimo Wolinski 1, Sepp D. Kohlwein 1, Anne
More informationElectronic Supplementary Information
Electronic Supplementary Material (ESI) for Molecular BioSystems. This journal is The Royal Society of Chemistry 2017 Electronic Supplementary Information Dissecting binding of a β-barrel outer membrane
More informationCytoPainter Golgi Staining Kit Green Fluorescence
ab139483 CytoPainter Golgi Staining Kit Green Fluorescence Instructions for Use Designed for the detection of Golgi bodies by microscopy This product is for research use only and is not intended for diagnostic
More informationAmanda H. Caster and Richard A. Kahn 1 From the Department of Biochemistry, Emory University School of Medicine, Atlanta, Georgia 30322
THE JOURNAL OF BIOLOGICAL CHEMISTRY VOL. 288, NO. 40, pp. 2867 2880, October 4, 2013 2013 by The American Society for Biochemistry and Molecular Biology, Inc. Published in the U.S.A. Recruitment of the
More informationmcherry Monoclonal Antibody (16D7) Catalog Number M11217 Product data sheet
Website: thermofisher.com Customer Service (US): 1 800 955 6288 ext. 1 Technical Support (US): 1 800 955 6288 ext. 441 mcherry Monoclonal Antibody (16D7) Catalog Number M11217 Product data sheet Details
More informationTightRegulation, Modulation, and High-Level Expression byvectors ContainingtheArabinose Promoter
TightRegulation, Modulation, and High-Level Expression byvectors ContainingtheArabinose Promoter L M Guzman et al. (1995) Journal of Bacteriology 177: 4121-4130 Outline 1. Introduction 2. Objective 3.
More informationImmunofluorescence images of different core histones and different histone exchange assay.
Molecular Cell, Volume 51 Supplemental Information Enhanced Chromatin Dynamics by FACT Promotes Transcriptional Restart after UV-Induced DNA Damage Christoffel Dinant, Giannis Ampatziadis-Michailidis,
More informationSupplement Figure 1. Characterization of the moab. (A) A series of moabs that are anti-hαiib-specific were tested for their ability to bind to
Supplement Figure 1. Characterization of the 312.8 moab. (A) A series of moabs that are anti-hαiib-specific were tested for their ability to bind to platelets. The black line represents the 312.8 moab
More information7.06 Problem Set #3, Spring 2005
7.06 Problem Set #3, Spring 2005 1. The Drosophila compound eye is composed of about 800 units called ommatidia. Each ommatidium contains eight photoreceptor neurons (R1 through R8), which develop in a
More informationAT2G02060 AT2G40260 AT2G AT4G04580 AT2G06020 AT2G AT5G06800 AT3G13040 AT2G AT5G AT3G04030
AT5G45580 75 AT3G10760 63 AT5G05090 92 AT2G40970 AT3G46640 LUX/PCL1 66 82 AT5G59570 BOA AT4G18020 PRR2 97 AT2G20570 GLK1 55 47 AT5G44190 GLK2 58 AT1G49560 HHO6 AT4G37180 HHO5 AT2G03500 HHO4 98 45 AT1G13300
More informationSupplemental Information. Stratum, a Homolog of the Human GEF Mss4, Partnered with Rab8, Controls the Basal Restriction
Cell Reports, Volume 18 Supplemental Information Stratum, a Homolog of the Human GEF Mss4, Partnered with Rab8, Controls the Basal Restriction of Basement Membrane Proteins in Epithelial Cells Olivier
More informationAssays for studying mitochondrial health and function
APPLICATION NOTE Fluorescence labeling and detection Assays for studying mitochondrial health and function Introduction Mitochondria play a critical role in maintaining normal cellular activities. Mitochondria
More informationDifferent Domains of the UBL-UBA Ubiquitin Receptor, Ddi1/Vsm1, Are Involved in Its Multiple Cellular Roles
Molecular Biology of the Cell Vol. 19, 3625 3637, September 2008 Different Domains of the UBL-UBA Ubiquitin Receptor, Ddi1/Vsm1, Are Involved in Its Multiple Cellular Roles Galina Gabriely, Rachel Kama,
More informationAmersham * ECL * Gel horizontal electrophoresis system
GE Healthcare Life Sciences Data file 28-9970-20 AB Electrophoresis products Amersham * ECL * Gel horizontal electrophoresis system Amersham ECL Gel and Amersham ECL Gel Box constitute a horizontal mini-gel
More informationSupplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling
Supplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling Glendining KA 1, Markie D 2, Gardner RJM 4, Franz EA 3, Robertson SP 4, Jasoni CL 1 Supplementary
More informationSOD1 as a Molecular Switch for Initiating the Homeostatic ER Stress Response under Zinc Deficiency
Molecular Cell, Volume 52 Supplemental Information SOD1 as a Molecular Switch for Initiating the Homeostatic ER Stress Response under Zinc Deficiency Kengo Homma, Takao Fujisawa, Naomi Tsuburaya, Namiko
More informationab Hypoxic Response Human Flow Cytometry Kit
ab126585 Hypoxic Response Human Flow Cytometry Kit Instructions for Use For measuring protein levels by flow cytometry: hypoxia-inducible factor 1-alpha (HIF1A) and BCL2/adenovirus E1B 19 kda proteininteracting
More informationMayumi Egawa, Kaori Mukai, Soichiro Yoshikawa, Misako Iki, Naofumi Mukaida, Yohei Kawano, Yoshiyuki Minegishi, and Hajime Karasuyama
Immunity, Volume 38 Supplemental Information Inflammatory Monocytes Recruited to Allergic Skin Acquire an Anti-inflammatory M2 Phenotype via Basophil-Derived Interleukin-4 Mayumi Egawa, Kaori Mukai, Soichiro
More informationSUMOstar Gene Fusion Technology
Gene Fusion Technology NEW METHODS FOR ENHANCING FUNCTIONAL PROTEIN EXPRESSION AND PURIFICATION IN INSECT CELLS White Paper June 2007 LifeSensors Inc. 271 Great Valley Parkway Malvern, PA 19355 www.lifesensors.com
More informationContents... vii. List of Figures... xii. List of Tables... xiv. Abbreviatons... xv. Summary... xvii. 1. Introduction In vitro evolution...
vii Contents Contents... vii List of Figures... xii List of Tables... xiv Abbreviatons... xv Summary... xvii 1. Introduction...1 1.1 In vitro evolution... 1 1.2 Phage Display Technology... 3 1.3 Cell surface
More informationLecture 25 (11/15/17)
Lecture 25 (11/15/17) Reading: Ch9; 328-332 Ch25; 990-995, 1005-1012 Problems: Ch9 (study-guide: applying); 1,2 Ch9 (study-guide: facts); 7,8 Ch25 (text); 1-3,5-7,9,10,13-15 Ch25 (study-guide: applying);
More informationHeme utilization in the Caenorhabditis elegans hypodermal cells is facilitated by hemeresponsive
Supplemental Data Heme utilization in the Caenorhabditis elegans hypodermal cells is facilitated by hemeresponsive gene-2 Caiyong Chen 1, Tamika K. Samuel 1, Michael Krause 2, Harry A. Dailey 3, and Iqbal
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION Conserved arginines on the rim of Hfq catalyze base pair formation and exchange Subrata Panja and Sarah A. Woodson T.C. Jenkins Department of Biophysics, Johns Hopkins University,
More informationThe microtubule-associated tau protein has intrinsic acetyltransferase activity. Todd J. Cohen, Dave Friedmann, Andrew W. Hwang, Ronen Marmorstein and
SUPPLEMENTARY INFORMATION: The microtubule-associated tau protein has intrinsic acetyltransferase activity Todd J. Cohen, Dave Friedmann, Andrew W. Hwang, Ronen Marmorstein and Virginia M.Y. Lee Cohen
More informationSome types of Mutagenesis
Mutagenesis What Is a Mutation? Genetic information is encoded by the sequence of the nucleotide bases in DNA of the gene. The four nucleotides are: adenine (A), thymine (T), guanine (G), and cytosine
More informationBiochimie II. Assistants Ben Brankatschk Eleonora Torti
Biochimie II Purification de protéines exprimées dans des cellules humaines en culture Daniel Abegg Christophe Berthier Pauline Bonvin abegg6@etu.unige.ch berthie4@etu.unige.ch bonvinp0@etu.unige.ch Assistants
More information64 CuCl 2 in 50 µl 0.1N NaOAc buffer, and 20 µg of each DOTA-antibody conjugate in 40 µl
Number of DOTA per antibody The average number of DOTA chelators per antibody was measured using a reported procedure with modifications (1,2). Briefly, nonradioactive CuCl 2 (80-fold excess of DOTA antibodies)
More informationStabilization of a virus-like particle and its application as a nanoreactor at physiological conditions
Supporting Information Stabilization of a virus-like particle and its application as a nanoreactor at physiological conditions Lise Schoonen, b Sjors Maassen, b Roeland J. M. Nolte b and Jan C. M. van
More informationCBI Toolbox Tour 2015
CBI Toolbox Tour 2015 Thermophoresis (NanoTemper) NT.115 & NT.LabelFree Images: NanoTemper Circular Dichroism Jasco J-1500 Spectrometer Six Position Turreted Peltier Temperature Control System Automated
More informationTargeting of a Nicotiana plumbaginifolia H 1 -ATPase to the Plasma Membrane Is Not by Default and Requires Cytosolic Structural Determinants
The Plant Cell, Vol. 16, 1772 1789, July 2004, www.plantcell.org ª 2004 American Society of Plant Biologists Targeting of a Nicotiana plumbaginifolia H 1 -ATPase to the Plasma Membrane Is Not by Default
More informationNature Neuroscience: doi: /nn Supplementary Figure 1
Supplementary Figure 1 PCR-genotyping of the three mouse models used in this study and controls for behavioral experiments after semi-chronic Pten inhibition. a-c. DNA from App/Psen1 (a), Pten tg (b) and
More informationFigure S1. MUT-16 localization in L4 hermaphrodite, adult hermaphrodite, and adult male germlines. MUT-16 DAPI. Phillips et al. S-1. male.
Supplementary Material for Phillips et al. Figure S1. MUT-16 localization in L4 hermaphrodite, adult hermaphrodite, and adult male germlines. Figure S2. Mutator foci and P granules localize independently
More informationOPTICAL CONTROL OF TUMOR INDUCTION IN THE ZEBRAFISH
OPTICAL CONTROL OF TUMOR INDUCTION IN THE ZEBRAFISH Zhiping Feng, 1,12 Suzy Nam, 2 Fatima Hamouri, 3,4 Isabelle Aujard, 5,6 Bertrand Ducos, 3,4 Sophie Vriz, 7,8 Michel Volovitch, 7,9 Ludovic Jullien, 5,6
More informationUNIVERSITY OF CAMBRIDGE INTERNATIONAL EXAMINATIONS General Certificate of Education Advanced Level
UNIVERSITY OF CAMBRIDGE INTERNATIONAL EXAMINATIONS General Certificate of Education Advanced Level *1053462426* BIOLOGY 9700/43 Paper 4 Structured Questions A2 October/November 2010 2 hours Candidates
More informationMultiplex Fluorescence Assays for Adherence Cells without Trypsinization
Multiplex Fluorescence Assays for Adherence Cells without Trypsinization The combination of a bright field and three fluorescent channels allows the Celigo to perform many multiplexed assays. A gating
More informationCase 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 29 September 2005
Case 7 A Storage Protein From Seeds of Brassica nigra is a Serine Protease Inhibitor Last modified 9 September 005 Focus concept Purification of a novel seed storage protein allows sequence analysis and
More informationFig. S1. Nature Medicine: doi: /nm HoxA9 expression levels BM MOZ-TIF2 AML BM. Sca-1-H. c-kit-h CSF1R-H CD16/32-H. Mac1-H.
A 1 4 1 4 1 4 CSF1RH 1 3 1 2 1 1 CSF1RH 1 3 1 2 1 1 CSF1RH 1 3 1 2 1 1 1 1 1 1 1 2 1 3 1 4 GFPH 1 1 1 1 1 2 1 3 1 4 Sca1H 1 1 1 1 1 2 1 3 1 4 ckith 1 4 1 4 1 4 CSF1RH 1 3 1 2 1 1 CSF1RH 1 3 1 2 1 1 CSF1RH
More informationBINF 6010 ITSC 8010 Spring 2010 Biotechnology & Genomics Lab Experimental Design- Technical.
BINF 6010 ITSC 8010 Spring 2010 Biotechnology & Genomics Lab Experimental Design- Technical http://webpages.uncc.edu/~jweller2 Topics Experimental Design - sources of technical variation Library construction
More informationqpcr Quantitative PCR or Real-time PCR Gives a measurement of PCR product at end of each cycle real time
qpcr qpcr Quantitative PCR or Real-time PCR Gives a measurement of PCR product at end of each cycle real time Differs from endpoint PCR gel on last cycle Used to determines relative amount of template
More informationCHAPTER 9 DNA Technologies
CHAPTER 9 DNA Technologies Recombinant DNA Artificially created DNA that combines sequences that do not occur together in the nature Basis of much of the modern molecular biology Molecular cloning of genes
More informationAccuPower PCR PreMix 73. AccuPower Taq PCR PreMix 77. AccuPower PCR PreMix (with UDG) 79. AccuPower HotStart PCR PreMix 81
PCR PreMix 73 AccuPower Taq PCR PreMix 77 AccuPower PCR PreMix (with UDG) 79 AccuPower HotStart PCR PreMix 81 AccuPower PyroHotStart Taq PCR PreMix 84 AccuPower HotStart PCR PreMix (with UDG) 87 AccuPower
More informationSupplemental Data. mir156-regulated SPL Transcription. Factors Define an Endogenous Flowering. Pathway in Arabidopsis thaliana
Cell, Volume 138 Supplemental Data mir156-regulated SPL Transcription Factors Define an Endogenous Flowering Pathway in Arabidopsis thaliana Jia-Wei Wang, Benjamin Czech, and Detlef Weigel Table S1. Interaction
More informationSpectral Separation of Multifluorescence Labels with the LSM 510 META
Microscopy from Carl Zeiss Spectral Separation of Multifluorescence Labels with the LSM 510 META Indians living in the South American rain forest can distinguish between almost 200 hues of green in their
More informationFigure S2. Response of mouse ES cells to GSK3 inhibition. Mentioned in discussion
Stem Cell Reports, Volume 1 Supplemental Information Robust Self-Renewal of Rat Embryonic Stem Cells Requires Fine-Tuning of Glycogen Synthase Kinase-3 Inhibition Yaoyao Chen, Kathryn Blair, and Austin
More informationTECHNICAL BULLETIN. In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits
In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits Catalog Numbers APPA001 In Vitro Bacterial Split GFP "Fold 'n' Glow" Solubility Assay Kit (Green) APPA008 In Vitro Bacterial
More informationSupplementary Materials: Viral Protein Kinetics of Piscine Orthoreovirus Infection in Atlantic Salmon Blood Cells
S1of S7 Supplementary Materials: Viral Protein Kinetics of Piscine Orthoreovirus Infection in Atlantic Salmon Blood Cells Hanne Merethe Haatveit, Øystein Wessel, Turhan Markussen, Morten Lund, Bernd Thiede,
More informationSupplemental Fig. S1. Key to underlines: Key to amino acids:
AspA-F1 AspA 1 MKQMETKGYGYFRKTKAYGLVCGIT--------------LAGALTLGTTSVSADDVTTLNPATNLTTLQTPPTADQTQLAHQAGQQSGELVSEVSNTEWD 86 SspB 1 MQKREV--FG-FRKSKVAKTLCGAV-LGAALIAIADQQVLADEVTETNSTANVAVTTTGNPATNLPEAQGEATEAASQSQAQAGSKDGALPVEVSADDLN
More informationNature Structural and Molecular Biology: doi: /nsmb.2937
Supplementary Figure 1 Multiple sequence alignment of the CtIP N-terminal domain, purified CtIP protein constructs and details of the 2F o F c electron density map of CtIP-NTD. (a) Multiple sequence alignment,
More informationAutomated Imaging and Dual-Mask Analysis of γh2ax Foci to Determine DNA Damage on an Individual Cell Basis
A p p l i c a t i o n N o t e Automated Imaging and Dual-Mask Analysis of γh2ax Foci to Determine DNA Damage on an Individual Cell Basis Brad Larson, BioTek Instruments, Inc., Winooski, VT USA Asha Sinha
More informationCalcium-dependent modulation and plasma membrane targeting of the AKT2 potassium channel by the CBL4/ CIPK6 calcium sensor/protein kinase complex
1116 ORIGINAL ARTICLE Cell Research (2011) 21:1116-1130. 2011 IBCB, SIBS, CAS All rights reserved 1001-0602/11 $ 32.00 www.nature.com/cr npg Calcium-dependent modulation and plasma membrane targeting of
More informationNature Immunology: doi: /ni Supplementary Figure 1
Supplementary Figure 1 BALB/c LYVE1-deficient mice exhibited reduced lymphatic trafficking of all DC subsets after oxazolone-induced sensitization. (a) Schematic overview of the mouse skin oxazolone contact
More informationImmunofluorescence Staining Protocol for 3 Well Chamber, removable
Immunofluorescence Staining Protocol for 3 Well Chamber, removable This Application Note presents a simple protocol for the cultivation, fixation, and staining of cells using the 3 Well Chamber, removable.
More informationTechnical Note. Housekeeping Protein Validation Protocol
Technical Note Housekeeping Protein Validation Protocol Published March 2017. The most recent version of this Technical Note is posted at licor.com/bio/support. Visit us on protocols.io! Explore an interactive
More informationSupplementary Data: Fig. 1S Detailed description of In vivo experimental design
1 2 Supplementary Data: Fig. 1S Detailed description of In vivo experimental design 3 4 5 6 7 8 9 Relative Expression Studies 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 The
More informationSupplemental Data. Regulating Gene Expression. through RNA Nuclear Retention
Supplemental Data Regulating Gene Expression through RNA Nuclear Retention Kannanganattu V. Prasanth, Supriya G. Prasanth, Zhenyu Xuan, Stephen Hearn, Susan M. Freier, C. Frank Bennett, Michael Q. Zhang,
More information