oligonucleotide primers listed in Supplementary Table 2 and cloned into ppcr-script (Stratagene) before digestion

Supplementary information, Data S1 MATERIALS AND METHODS. Growth of Arabidopsis and rice plants

Supplementary information, Data S1 MATERIALS AND METHODS Growth of Arabidopsis and rice plants Arabidopsis thaliana ecotype Columbia (Col-0) was used in all experiments. Seeds were sown on MS plates and

Supplementary information, Figure S1

Supplementary information, Figure S1 (A) Schematic diagram of the sgrna and hspcas9 expression cassettes in a single binary vector designed for Agrobacterium-mediated stable transformation of Arabidopsis

Schematic representation of the endogenous PALB2 locus and gene-disruption constructs

Supplementary Figures Supplementary Figure 1. Generation of PALB2 -/- and BRCA2 -/- /PALB2 -/- DT40 cells. (A) Schematic representation of the endogenous PALB2 locus and gene-disruption constructs carrying

Supplementary Figure 1 Collision-induced dissociation (CID) mass spectra of peptides from PPK1, PPK2, PPK3 and PPK4 respectively.

Supplementary Figure 1 lision-induced dissociation (CID) mass spectra of peptides from PPK1, PPK, PPK3 and PPK respectively. % of nuclei with signal / field a 5 c ppif3:gus pppk1:gus 0 35 30 5 0 15 10

Supplemental Data. Na Xu et al. (2016). Plant Cell /tpc

Supplemental Figure 1. The weak fluorescence phenotype is not caused by the mutation in At3g60240. (A) A mutation mapped to the gene At3g60240. Map-based cloning strategy was used to map the mutated site

Supplementary Materials for

www.sciencesignaling.org/cgi/content/full/5/244/ra72/dc1 Supplementary Materials for An Interaction Between BZR1 and DELLAs Mediates Direct Signaling Crosstalk Between Brassinosteroids and Gibberellins

Figure S1. Immunoblotting showing proper expression of tagged R and AVR proteins in N. benthamiana.

SUPPLEMENTARY FIGURES Figure S1. Immunoblotting showing proper expression of tagged R and AVR proteins in N. benthamiana. YFP:, :CFP, HA: and (A) and HA, CFP and YFPtagged and AVR1-CO39 (B) were expressed

Design. Construction. Characterization

Design Construction Characterization DNA mrna (messenger) A C C transcription translation C A C protein His A T G C T A C G Plasmids replicon copy number incompatibility selection marker origin of replication

Figure S1. DELLA Proteins Act as Positive Regulators to Mediate GA-Regulated Anthocyanin

Supplemental Information Figure S1. DELLA Proteins Act as Positive Regulators to Mediate GA-Regulated Anthocyanin Biosynthesis. (A) Effect of GA on anthocyanin content in WT and ga1-3 seedlings. Mock,

SUPPLEMENTARY INFORMATION

R2A MASNSEKNPLL-SDEKPKSTEENKSS-KPESASGSSTSSAMP---GLNFNAFDFSNMASIL 56 R2B MASSSEKTPLIPSDEKNDTKEESKSTTKPESGSGAPPSPS-PTDPGLDFNAFDFSGMAGIL 60 R2A NDPSIREMAEQIAKDPAFNQLAEQLQRSIPNAGQEGGFPNFDPQQYVNTMQQVMHNPEFK

Title: Geminiviruses subvert ubiquitination and inhibit jasmonate signalling by altering CSN-mediated de-rubylation of SCF E3 ligase complexes

SUPPLEMENTAL DATA Title: Geminiviruses subvert ubiquitination and inhibit jasmonate signalling by altering CSN-mediated de-rubylation of SCF E3 ligase complexes A Mock TYLCSV TYLCSV C2 T2C dsdna ssdna

Supplemental Materials

Supplemental Materials Flores-Pérez et al., Supplemental Materials, page 1 of 5 Supplemental Figure S1. Pull-down and BiFC controls, and quantitative analyses associated with the BiFC studies. (A) Controls

Yeast 2-Hybrid Kayla Nygaard

Yeast 2-Hybrid 2.26.18 Kayla Nygaard Y2H - What is it? A method to screen for protein-protein interactions in yeast Capitalizes on GAL4 system in yeast. GAL4 has 2 domains DNA-Binding Domain (DB) Transcriptional

(b) Genotyping of SALK_ (AT1g51690) and SALK_ (At1g17720) to find homozygous single mutant plants.

Supplemental Table 1. Primers used for cloning and RT-PCR. The B-type subunits cdna CDS were amplified using high-fidelity PCR amplification with gene specific primers. The cdna CDS sequences were obtained

Running head; Gateway TM vectors for high-throughput functional analysis

Running head; Gateway TM vectors for high-throughput functional analysis Mark D. Curtis Institute of Plant Biology and Zürich-Basel Plant Science Centre, University of Zürich, Zollikerstrasse 107, CH-8008

Review of previous work: Overview of previous work on DNA methylation and chromatin dynamics

CONTENTS Preface Acknowledgements Lists of Commonly Used Abbreviations Review of previous work: Overview of previous work on DNA methylation and chromatin dynamics Introduction Enzymes involved in DNA

A 5 P degradation hot spot influences molecular farming of anticancerogenic nuclease TBN1 in tobacco cells

Plant Cell, Tissue and Organ Culture (PCTOC) A 5 P degradation hot spot influences molecular farming of anticancerogenic nuclease TBN1 in tobacco cells Anna Týcová a,b, Rajen J. J. Piernikarczyk c, Michael

Enhancers mutations that make the original mutant phenotype more extreme. Suppressors mutations that make the original mutant phenotype less extreme

Interactomics and Proteomics 1. Interactomics The field of interactomics is concerned with interactions between genes or proteins. They can be genetic interactions, in which two genes are involved in the

Live-cell visualization of excitation energy dynamics in chloroplast thylakoid structures

Supplementary Information Live-cell visualization of excitation energy dynamics in chloroplast thylakoid structures Masakazu Iwai, Makio Yokono, Kazuo Kurokawa, Akira Ichihara & Akihiko Nakano Supplementary

Supplemental materials

Supplemental materials Materials and methods for supplemental figures Yeast two-hybrid assays TAP46-PP2Ac interactions I. The TAP46 was used as the bait and the full-length cdnas of the five C subunits

pri 201 DNA Series (High-Expression Vectors for Plant Transformation)

For Research Use Cat #. 3264 3265 3266 3267 pri 201 DNA Series (High-Expression Vectors for Plant Transformation) Product Manual Table of Contents I. Description... 3 II. Product Information... 3 III.

Expression constructs used in this study: Rtn1pQM-Ntag/A. The expression vector was generated as described previously (Mannan et al., 2006).

Supplementary file 1 Sequences of primers used: C-mycTag-new-F: 5 CCGAATTCCGTCGGAGCAAGCTTGATTTA3 Ad.C-mycTag-R: 5 TTGCGGCCGCCTTTTGCTCCATGGTGAGGTC3 adpxt1-orf-f: 5 GGTGCGGCCGCTGGTGGCATGCAGCTTAGACACATTGG3

MIT Department of Biology 7.013: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr.

MIT Department of Biology 7.01: Introductory Biology - Spring 2005 Instructors: Professor Hazel Sive, Professor Tyler Jacks, Dr. Claudette Gardel iv) Would Xba I be useful for cloning? Why or why not?

PHT1;2-CFP YFP-PHF + PHT1;2-CFP YFP-PHF

YFP-PHF1 CFP-PHT1;2 PHT1;2-CFP YFP-PHF + PHT1;2-CFP YFP-PHF + CFP-PHT1;2 Negative control!-gfp Supplemental Figure 1: PHT1;2 accumulation is PHF1 dependent. Immunoblot analysis on total protein extract

For designing necessary primers and oligos for grna, online CRISPR designing tools can be used (e.g.

DESIGN OF grnas For designing necessary primers and oligos for grna, online CRISPR designing tools can be used (e.g. http://crispr.mit.edu/, https://benchling.com). Assembly of grna transcriptional cassettes

Supplemental Data. Liu et al The MYB305 transcription factor regulates expression of Nectarin genes in the ornamental tobacco floral nectar.

Supplemental Data. Liu et al. 2009. The MYB305 transcription factor regulates expression of Nectarin genes in the ornamental tobacco floral nectar. RT-PCR of genes of interest in the foliage of wild-type

Supplemental Data. Borg et al. Plant Cell (2014) /tpc

Supplementary Figure 1 - Alignment of selected angiosperm DAZ1 and DAZ2 homologs Multiple sequence alignment of selected DAZ1 and DAZ2 homologs. A consensus sequence built using default parameters is shown

Intron distance to transcription start (nt)*

Schwab et al. SOM: Enhanced microrna accumulation through stemloop-adjacent introns 1 Supplemental Table 1. Characteristics of introns used in this study Intron name Length intron (nt) Length cloned fragment

Supplemental Data. Polycomb Silencing of KNOX Genes Confines. Shoot Stem Cell Niches in Arabidopsis Current Biology, Volume 18

Supplemental Data Polycomb Silencing of KNOX Genes Confines Shoot Stem Cell Niches in Arabidopsis Lin Xu and Wen-Hui Shen - 1 - Figure S1. Phylogram of RING1, BMI1 and RAD18 homologues in several organisms

Supplemental Figure 1. Mutation in NLA Causes Increased Pi Uptake Activity and

Supplemental Figure 1. Mutation in NLA Causes Increased Pi Uptake Activity and PHT1 Protein Amounts. (A) Shoot morphology of 19-day-old nla mutants under Pi-sufficient conditions. (B) [ 33 P]Pi uptake

Supplemental Data. Farmer et al. (2010) Plant Cell /tpc

Supplemental Figure 1. Amino acid sequence comparison of RAD23 proteins. Identical and similar residues are shown in the black and gray boxes, respectively. Dots denote gaps. The sequence of plant Ub is

AD BD TOC1. Supplementary Figure 1: Yeast two-hybrid assays showing the interaction between

AD X BD TOC1 AD BD X PIFΔAD PIF TOC1 TOC1 PIFΔAD PIF N TOC1 TOC1 C1 PIFΔAD PIF C1 TOC1 TOC1 C PIFΔAD PIF C TOC1 Supplementary Figure 1: Yeast two-hybrid assays showing the interaction between PIF and TOC1

Gateway Vectors for BiFC

Gateway Vectors for BiFC 1. The enhanced YFP (EYFP) are used (Split EYFP). 2. The Fusion fusion gene is expressed by CaMV35S promoter. 3. The N- or C-terminal fragments of EYFP are fused subsequent to

Data Sheet Quick PCR Cloning Kit

Data Sheet Quick PCR Cloning Kit 6044 Cornerstone Ct. West, Ste. E DESCRIPTION: The Quick PCR Cloning Kit is a simple and highly efficient method to insert any gene or DNA fragment into a vector, without

SUPPLEMENTARY EXPEMENTAL PROCEDURES

SUPPLEMENTARY EXPEMENTAL PROCEDURES Plasmids- Total RNAs were extracted from HeLaS3 cells and reverse-transcribed using Superscript III Reverse Transcriptase (Invitrogen) to obtain DNA template for the

Supplemental Figure 1

Supplemental Figure 1 A gta2-1 gta2-2 1kb AT4G08350 B Col-0 gta2-1 LP+RP+LBb1.3 C Col-0 gta2-2 LP+RP+LB1 D Col-0 gta2-2 gta2-1 GTA2 TUBLIN E Col0 gta2-1 gta2-2 Supplemental Figure 1. Phenotypic analysis

Chapter 20 Recombinant DNA Technology. Copyright 2009 Pearson Education, Inc.

Chapter 20 Recombinant DNA Technology Copyright 2009 Pearson Education, Inc. 20.1 Recombinant DNA Technology Began with Two Key Tools: Restriction Enzymes and DNA Cloning Vectors Recombinant DNA refers

SUPPLEMENTARY INFORMATION

Gene replacements and insertions in rice by intron targeting using CRISPR Cas9 Table of Contents Supplementary Figure 1. sgrna-induced targeted mutations in the OsEPSPS gene in rice protoplasts. Supplementary

Antisense RNA Targeting the First Periplasmic Domain of YidC in Escherichia coli Appears to Induce Filamentation but Does Not Affect Cell Viability

Antisense RNA Targeting the First Periplasmic Domain of YidC in Escherichia coli Appears to Induce Filamentation but Does Not Affect Cell Viability Riaaz Lalani, Nathaniel Susilo, Elisa Xiao, Andrea Xu

Supplemental Data. Osakabe et al. (2013). Plant Cell /tpc

Supplemental Figure 1. Phylogenetic analysis of KUP in various species. The amino acid sequences of KUPs from green algae and land plants were identified with a BLAST search and aligned using ClustalW

Chapter 10 (Part II) Gene Isolation and Manipulation

Biology 234 J. G. Doheny Chapter 10 (Part II) Gene Isolation and Manipulation Practice Questions: Answer the following questions with one or two sentences. 1. What does PCR stand for? 2. What does the

Supporting Information

Supporting Information Development of a 2,4-Dinitrotoluene-Responsive Synthetic Riboswitch in E. coli cells Molly E. Davidson, Svetlana V. Harbaugh, Yaroslav G. Chushak, Morley O. Stone, Nancy Kelley-

Fig. S1. CrgA intracellular levels in M. tuberculosis. Ten and twenty micrograms of

Supplementary data Fig. S1. CrgA intracellular levels in M. tuberculosis. Ten and twenty micrograms of cell free protein lysates from WT M. tuberculosis (Rv) together with various known concentrations

Different Upstream Activators Stimulate Transcription Through Distinct Coactivator Complexes

Supplemental Material for Different Upstream Activators Stimulate Transcription Through Distinct Coactivator Complexes Dong-ki Lee, Soyoun Kim, and John T. Lis Due to be published as a Research Communication

Transport of Potato Lipoxygenase into the Vacuole Larsen, Mia Kruse Guldstrand; Welinder, Karen Gjesing; Jørgensen, Malene

Aalborg Universitet Transport of Potato Lipoxygenase into the Vacuole Larsen, Mia Kruse Guldstrand; Welinder, Karen Gjesing; Jørgensen, Malene Publication date: 2009 Document Version Publisher's PDF, also

Supplementary Information

Supplementary Information MED18 interaction with distinct transcription factors regulates plant immunity, flowering time and responses to hormones Supplementary Figure 1. Diagram showing T-DNA insertion

Experimental Tools and Resources Available in Arabidopsis. Manish Raizada, University of Guelph, Canada

Experimental Tools and Resources Available in Arabidopsis Manish Raizada, University of Guelph, Canada Community website: The Arabidopsis Information Resource (TAIR) at http://www.arabidopsis.org Can order

SUPPLEMENTARY INFORMATION

Materials and Methods Transgenic Plant Materials and DNA Constructs. VEX1::H2B-GFP, ACA3::H2B-GFP, KRP6::H2B-GFP, KRP6::mock21ts-GFP, KRP6::TE21ts- GFP and KRP6::miR161ts-GFP constructs were generated

Supporting Information

Supporting Information Materials and Methods Plant Materials and Growth Conditions All Arabidopsis thaliana plants used in this study were of the Columbia-0 ecotype. 35S:PIF3-Myc (1), 35S:PIF4-Myc (2),

Supporting Information

Supporting Information Ju et al. 10.1073/pnas.1214848109 SI Materials and Methods Yeast Two-Hybrid Assay Constructs. The sequence encoding the ETHYLENE-INSENSITIVE2 (EIN2) C-terminal domain (residues 516

Supplementary Material for StairSTEPS Manuscript

Supplementary Material for StairSTEPS Manuscript S1. Supplementary Materials and Methods S1.1 Plasmid vector construction All plasmids for expression of dcas9 were derived from the pjed103 vector series

transcription and the promoter occupancy of Smad proteins. (A) HepG2 cells were co-transfected with the wwp-luc reporter, and FLAG-tagged FHL1,

Supplementary Data Supplementary Figure Legends Supplementary Figure 1 FHL-mediated TGFβ-responsive reporter transcription and the promoter occupancy of Smad proteins. (A) HepG2 cells were co-transfected

Construction of plant complementation vector and generation of transgenic plants

MATERIAL S AND METHODS Plant materials and growth conditions Arabidopsis ecotype Columbia (Col0) was used for this study. SALK_072009, SALK_076309, and SALK_027645 were obtained from the Arabidopsis Biological

Supplementary Information. c d e

Supplementary Information a b c d e f Supplementary Figure 1. atabcg30, atabcg31, and atabcg40 mutant seeds germinate faster than the wild type on ½ MS medium supplemented with ABA (a and d-f) Germination

Supporting Information

Supporting Information Risser and Callahan 10.1073/pnas.0909152106 SI Text Plasmid Construction. Plasmid pdr211 is a mobilizable shuttle vector containing P pete -pats. A fragment containing P pete was

Supplemental Data. Li et al. (2015). Plant Cell /tpc

Supplemental Data Supplemental Figure 1: Characterization of asr3 T-DNA knockout lines and complementation transgenic lines. (A) The scheme of At2G33550 (ASR3) with gray boxes indicating exons and dash

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION High-efficiency TALEN-based gene editing produces disease-resistance rice Ting Li 1, Bo Liu 1, Martin H. Spalding 1, Donald P. Weeks 2, Bing Yang 1 * 1 Department of Genetics,

Supporting information

Supporting information Construction of strains and plasmids To create ptc67, a PCR product obtained with primers cc2570-162f (gcatgggcaagcttgaggacggcgtcatgt) and cc2570+512f (gaggccgtggtaccatagaggcgggcg),

A subclass of HSP70s regulate development and abiotic stress responses in Arabidopsis thaliana

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 Journal of Plant Research A subclass of HSP70s regulate development and abiotic stress responses in Arabidopsis thaliana Linna Leng 1 Qianqian Liang

P52A/R67A. The plasmids expressing AD-fused Atg1 variants were constructed as follows: DNA

SUPPLEMENTAL DATA The Autophagy-Related Protein Kinase Atg1 Interacts with the Ubiquitin-Like Protein Atg8 via the Atg8 Family Interacting Motif to Facilitate Autophagosome Formation Hitoshi Nakatogawa,

Use of In-Fusion Cloning for Simple and Efficient Assembly of Gene Constructs No restriction enzymes or ligation reactions necessary

No restriction enzymes or ligation reactions necessary Background The creation of genetic circuits and artificial biological systems typically involves the use of modular genetic components biological

Reading Lecture 8: Lecture 9: Lecture 8. DNA Libraries. Definition Types Construction

Lecture 8 Reading Lecture 8: 96-110 Lecture 9: 111-120 DNA Libraries Definition Types Construction 142 DNA Libraries A DNA library is a collection of clones of genomic fragments or cdnas from a certain

Freire et al. - Supplemental Material for Trypanosoma brucei translation-initiation factor homolog EIF4E6 is linked to posttranscriptional regulation

Freire et al. - Supplemental Material for Trypanosoma brucei translation-initiation factor homolog EIF4E6 is linked to posttranscriptional regulation Table S1 Oligonucleotides used in this study Table

Supplementary Table S1. List of primers that were used. List of primers used in plasmid construction, virus detection and RT-PCR.

Supplementary Table S1. List of primers that were used. List of primers used in plasmid construction, virus detection and RT-PCR. Table S1 Name Sequences (5-3 ) Brief Description OYLT97 CGGAAGCTTGTCGACTGGCGGCCG

The RING-type E3 ubiquitin ligase MIEL1 targets the Arabidopsis transcription factor MYB30 for degradation and attenuates plant defense

The RING-type E3 ubiquitin ligase MIEL1 targets the Arabidopsis transcription factor MYB30 for degradation and attenuates plant defense Daniel Marino, Solène Froidure, Joanne Canonne, Sara Ben Khaled,

Supplemental Table 1. The progeny of crosses between MPK4/mpk4-2 and ANQ/anq-2. Genotype Number Number Number observed expected-1 expected-2 (1) MPK4/MPK4 ANQ/ANQ 32 12 21 (2) MPK4/MPK4 ANQ/anq-2 28 25

Supplemental Data. Lee et al. Plant Cell. (2010) /tpc Supplemental Figure 1. Protein and Gene Structures of DWA1 and DWA2.

Supplemental Figure 1. Protein and Gene Structures of DWA1 and DWA2. (A) Protein structures of DWA1 and DWA2. WD40 region was determined based on the NCBI conserved domain databases (B, C) Schematic representation

Supplementary Fig. 1

SalI plt52-gfp-tr4-nos mp R Nco I XbaI amhi SmaI amhi TG GG TT G GG T G GGG T GG GT T TG EcoRV SacI HindIII SphI PstI SalI 6pb 725pb 255 pb LT 52 GFP R4 NOS Nco I XbaI amhi SmaI amhi TG GG TT G GG T G

Molecular Biology Techniques Supporting IBBE

Molecular Biology Techniques Supporting IBBE Jared Cartwright Protein Production Lab Head Contact Details: email jared.cartwright@york.ac.uk Phone 01904 328797 Presentation Aims Gene synthesis Cloning

Targeted modification of gene function exploiting homology directed repair of TALENmediated double strand breaks in barley

Targeted modification of gene function exploiting homology directed repair of TALENmediated double strand breaks in barley Nagaveni Budhagatapalli a, Twan Rutten b, Maia Gurushidze a, Jochen Kumlehn a,

Supporting Information

Supporting Information Üstün and Börnke, 2015 Figure S1: XopJ does not display acetyltransferase activity. Autoacetylation activity in vitro. Acetylation reactions using MBP, MBP-XopJ, GST and GST-HopZ1a

Supplementary information

Supplementary information Supplementary figures Figure S1 Level of mycdet1 protein in DET1 OE-1, OE-2 and OE-3 transgenic lines. Total protein extract from wild type Col0, det1-1 mutant and DET1 OE lines

Understanding the Cellular Mechanism of the Excess Microsporocytes I (EMSI) Gene. Andrew ElBardissi, The Pennsylvania State University

Understanding the Cellular Mechanism of the Excess Microsporocytes I (EMSI) Gene Andrew ElBardissi, The Pennsylvania State University Abstract: Hong Ma, The Pennsylvania State University The Excess Microsporocytes

Regulation of ARE transcript 3 end processing by the. yeast Cth2 mrna decay factor

Regulation of ARE transcript 3 end processing by the yeast Cth2 mrna decay factor Manoël Prouteau, Marie-Claire Daugeron and Bertrand Séraphin Supplementary Information Material and Methods Plasmid construction

Supplementary Figure S1. Immunodetection of full-length XA21 and the XA21 C-terminal cleavage product.

Supplementary Information Supplementary Figure S1. Immunodetection of full-length XA21 and the XA21 C-terminal cleavage product. Total protein extracted from Kitaake wild type and rice plants carrying

1. Introduction Drought stress and climate change Three strategies of plants in response to water stress 3

Contents 1. Introduction 1 1.1 Drought stress and climate change 3 1.2 Three strategies of plants in response to water stress 3 1.3 Three closely related species of Linderniaceae family are experimental

Supplemental Figure 1. Conserved regions of the kinase domain of PEPR1, PEPR2, CLV1 and BRI1.

Supplemental Figure 1. Conserved regions of the kinase domain of PEPR1, PEPR2, CLV1 and BRI1. The asterisks and colons indicate the important residues for ATP-binding pocket and substrate binding pocket,

Antibodies and reagents Construction and characterization of YFP-TF chimera

Antibodies and reagents Antibodies: mouse monoclonal antibodies (mab) against PDI (clone 34, BD Transduction and RL90, Affinity Bioreagents); rabbit polyclonals against bovine PDI (SPA-890, Stressgen and

To investigate the heredity of the WFP gene, we selected plants that were homozygous

Supplementary information Supplementary Note ST-12 WFP allele is semi-dominant To investigate the heredity of the WFP gene, we selected plants that were homozygous for chromosome 1 of Nipponbare and heterozygous

Supplemental Data. Aung et al. (2011). Plant Cell /tpc

35S pro:pmd1-yfp 10 µm Supplemental Figure 1. -terminal YFP fusion of PMD1 (PMD1-YFP, in green) is localized to the cytosol. grobacterium cells harboring 35S pro :PMD1-YFP were infiltrated into tobacco

Marker Antibody Supplier. CD7 CD7 PE-CY 7 anti-human CD7 ebioscience, San Diego, USA

Supplementary Table 1: Flurochrome labelled antibody used Marker Antibody Supplier CD3 CD4 CD8 CD25 CD26 CD127 CCR4 CCR7 Ki67 Viability stain Alexa Fluor 700 anti-human CD3 Fluorescein isothiocyanate antihuman

Protocol for cloning SEC-based repair templates using Gibson assembly and ccdb negative selection

Protocol for cloning SEC-based repair templates using Gibson assembly and ccdb negative selection Written by Dan Dickinson (daniel.dickinson@austin.utexas.edu) and last updated January 2018. A version

Supplemental Data. Seo et al. (2014). Plant Cell /tpc

Supplemental Figure 1. Protein alignment of ABD1 from other model organisms. The alignment was performed with H. sapiens DCAF8, M. musculus DCAF8 and O. sativa Os10g0544500. The WD40 domains are underlined.

Cover Page. The handle holds various files of this Leiden University dissertation.

Cover Page The handle http://hdl.handle.net/1887/20958 holds various files of this Leiden University dissertation. Author: Sakalis, Philippe Alexandre Title: Visualizing virulence proteins and their translocation

Personal Exam Code: 1. 16p

Exam, Methods in Molecular Biology, BIOR47, 2012-04-26 Please hand in answers to each question on its paper. Use additional papers if needed. Mark all papers with your code. Your answers should be logical

Supplemental Data. Hu et al. Plant Cell (2017) /tpc

1 2 3 4 Supplemental Figure 1. DNA gel blot analysis of homozygous transgenic plants. (Supports Figure 1.) 5 6 7 8 Rice genomic DNA was digested with the restriction enzymes EcoRⅠ and BamHⅠ. Lanes in the

Biotechnology, Korea University of Science and Technology (UST), 217 Gajeong-ro, Daejeon 34113,

Supplementary Information Title: Orange protein has a role in phytoene synthase stabilization in sweetpotato Seyeon Park 1,2,, Ho Soo Kim 1,, Young Jun Jung 3,4, Sun Ha Kim 1, Chang Yoon Ji 1,2, Zhi Wang

Supplemental data. Zhao et al. (2009). The Wuschel-related homeobox gene WOX11 is required to activate shoot-borne crown root development in rice.

Supplemental data. Zhao et al. (2009). The Wuschel-related homeobox gene WOX11 is required to activate shoot-borne crown root development in rice. A B Supplemental Figure 1. Expression of WOX11p-GUS WOX11-GFP

CoralHue Fluo-chase Kit

Amalgaam For Research Use Only. Not for use in diagnostic procedures. Protein-Protein Interaction Analysis CoralHue Fluo-chase Kit Code No. AM-1100 15 B Constitution Way Woburn, MA 01801 Phone: 1.800.200.5459

Factors affecting PCR

Lec. 11 Dr. Ahmed K. Ali Factors affecting PCR The sequences of the primers are critical to the success of the experiment, as are the precise temperatures used in the heating and cooling stages of the

3 -end. Sau3A. 3 -end TAA TAA. ~9.1kb SalI TAA. ~12.6kb. HindШ ATG 5,860bp TAA. ~12.7kb

Supplemental Data. Chen et al. (2008). Badh2, encoding betaine aldehyde dehydrogenase, inhibits the biosynthesis of 2-acetyl-1-pyrroline, a major component in rice fragrance. A pcam-cah/cah Sau3A Promoter

XXII DNA cloning and sequencing. Outline

XXII DNA cloning and sequencing 1) Deriving DNA for cloning Outline 2) Vectors; forming recombinant DNA; cloning DNA; and screening for clones containing recombinant DNA [replica plating and autoradiography;

Chapter 8: Recombinant DNA. Ways this technology touches us. Overview. Genetic Engineering

Chapter 8 Recombinant DNA and Genetic Engineering Genetic manipulation Ways this technology touches us Criminal justice The Justice Project, started by law students to advocate for DNA testing of Death

Candidate region (0.74 Mb) ATC TCT GGG ACT CAT GAG CAG GAG GCT AGC ATC TCT GGG ACT CAT TAG CAG GAG GCT AGC

A idm-3 idm-3 B Physical distance (Mb) 4.6 4.86.6 8.4 C Chr.3 Recom. Rate (%) ATG 3.9.9.9 9.74 Candidate region (.74 Mb) n=4 TAA D idm-3 G3T(E4) G4A(W988) WT idm-3 ATC TCT GGG ACT CAT GAG CAG GAG GCT AGC

SUPPLEMENTARY INFORMATION

Supplementary Methods Constructs SUPPLEMENTARY INFORMATION Identification of the transporter responsible for sucrose accumulation in sugar beet taproots cdna from Beta vulgaris was generated by reverse

Supplemental Data. Zhang et al. (2013). Plant Cell /tpc

SDLTXgal SDLTH SDLTHA ADSV4 BD BDP53 BD BDP53 BD BDP53 ADAt1g1567(aa36358) ADAt1g844(aa9354) ADAt1g844(aa51354) ADAt1g844(full) Prey ADAt1g844(aa11354) ADAt3g5994(aa48418) BD BDPAL2 BD BDPAL2 BD BDPAL2

Figure S1. gfp tola and pal mcherry can complement deletion mutants of tola and pal respectively. (A)When strain LS4522 was grown in the presence of

Figure S1. gfp tola and pal mcherry can complement deletion mutants of tola and pal respectively. (A)When strain LS4522 was grown in the presence of xylose, inducing expression of gfp-tola, localization

- 1 - Supplemental Data

- 1-1 Supplemental Data 2 3 4 5 6 7 8 9 Supplemental Figure S1. Differential expression of AtPIP Genes in DC3000-inoculated plants. Gene expression in leaves was analyzed by real-time RT-PCR and expression

Recombinant DNA Technology

History of recombinant DNA technology Recombinant DNA Technology (DNA cloning) Majid Mojarrad Recombinant DNA technology is one of the recent advances in biotechnology, which was developed by two scientists

Supplementary Figure 1. Nature Structural & Molecular Biology: doi: /nsmb.3494

Supplementary Figure 1 Pol structure-function analysis (a) Inactivating polymerase and helicase mutations do not alter the stability of Pol. Flag epitopes were introduced using CRISPR/Cas9 gene targeting