Racine et al, Histone H2B ubiquitylation promotes activity of the intact Set1 histone methyltransferase complex in fission yeast
|
|
- Marcia Bryant
- 5 years ago
- Views:
Transcription
1 Supplemental Materials Racine et al, Histone H2B ubiquitylation promotes activity of the intact Set histone methyltransferase complex in fission yeast Supplemental Experimental Procedures Table S Figures S-S5
2 Supplemental Experimental Procedures Denaturing whole-cell extract preparation- Extracts were prepared using a trichloroacetic acid lysis method as previously described (). Chromatin immunoprecipitation (ChIP) analysis of H3K4me3-ChIP was carried out using a H3K4me3-specific antibody purchased from Abcam (ab8580). The total H3 antibody was a generous gift from A. Verreault. Quantitative RT-PCR analysis-total S. pombe RNA was isolated using a hot phenol method as described previously (). RNA was converted to cdna using a RevertAid kit (Fermentas) and analyzed by qpcr using SYBR Green PCR mix (Biorad). Primers for act + were as described (2). Table S. S. pombe strains used in this study. Name Genotype Source JTB204 h- ade6-m26 Tanny et al., 2007 JTB24 spf-tap::kanmx6 leu-32 ura4-d8 his3-d ade6-m20 h- Roguev et al., 2003 JTB242 set-tap::kanmx6 leu-32 ura4-d8 his3-d ade6-m20 h- Roguev et al., 2003 JTB405 set-tap::kanmx6 brl2δ::hphmx4 leu- This study 32 ura4-d8 ade6 h? JTB404 set-tap::kanmx6 htb-k9r::kanmx6 ade6 h? JTB450 swd2.-tap::kanmx6 ade6-m26 h- This study JTB454 swd2.-tap::kanmx6 brl2δ::hphmx4 This study ade6-m26 h- JTB253-3 spf-tap::kanmx6 htb-k9r- FLAG::kanMX6 ade6 h? This study JTB46 spf-tap::kanmx6 brl2δ::hphmx4 ade6 This study h? JTB478 swd2.-tap::kanmx6 htb-k9r- This study FLAG::kanMX6 ade6 h? JTB202 rtf-tap::kanmx6 ade6-m26 h- This study JTB367 rtf-tap::kanmx6 htb-k9r::kanmx6 ade6 h- This study SUPPLEMENTAL REFERENCES. Tanny, J. C., Erdjument-Bromage, H., Tempst, P., and Allis, C. D. (2007) Genes Dev 2, Guiguen, A., Soutourina, J., Dewez, M., Tafforeau, L., Dieu, M., Raes, M., Vandenhaute, J., Werner, M., and Hermand, D. (2007) EMBO J 26, Figure S. The spf-tap strain has wild-type levels of H3K4me in vivo. Denaturing whole-cell extracts from untagged (JTB204) and spf-tap (JTB24) strains were analyzed by western blotting with the indicated antibodies. Figure S2. Extended time course of in vitro SetC methyltransferase reactions. The indicated mononucleosome substrates were incubated in the presence of SetC at 30 o C and analyzed by western blotting. Incubation times and antibodies are indicated on the right.
3 Figure S3. Expression of SetC subunits in wild-type and H2Bub-deficient strains. (A) Denaturing whole-cell extracts from the indicated TAP strains ( WT -wild-type; K -htb- K9R; B -brl2δ) were analyzed by western blotting with an anti-tap antibody. Corresponding strain numbers are JTB24, JTB253-3, JTB46, JTB450, JTB478, JTB454, JTB242, JTB405. (B) Quantification of band intensities for independent replicates of the blot shown in (A). For each sample [numbered -8 as shown in (A)] the TAP signal was normalized to the tubulin signal, and then normalized to the corresponding wild-type tagged strain. Figure S4. Chromatin immunoprecipitation (ChIP) analysis of H3K4me3 levels at act +. ChIP was carried out in a wild-type strain using antibodies against H3K4me3 and total histone H3 and analyzed by qpcr as described in Experimental Procedures. Relative enrichment of H3K4me3 at each position is expressed as a fraction of the total H3 enrichment. Figure S5. Transcription of act + is not defective in H2Bub-deficient strains. (A) Equal amounts of total RNA from each strain (JTB204, JTB86-3, JTB33, respectively) was converted into cdna and analyzed by qpcr for act + transcript. Transcript abundance in the indicated strains relative to wild-type was measured in two independent experiments; error bars denote standard deviations. (B) ChIP was carried out in the indicated TAP-tagged strains (JTB202, JTB367) and analyzed by qpcr as described in Materials and Methods. ChIP signals are expressed as a percentage of the input signal for each primer pair. Normalization was carried out by subtracting the background %IP obtained from an untagged strain. Error bars denote standard deviations from 3 independent experiments.
4 Figure S H3K4me H3K4me2 H3K4me3 H3
5 Figure S2 Unmodified H2Bub Time (hours) H3K4me2 H3
6 A Figure S3 spf-tap swd2.-tap set-tap WT K B WT K B WT B TAP tubulin B.2 Relative normalized intensity
7 Figure S4 2 3 act + Relative enrichment (H3K4me3/H
8 Figure S5 A.4.2 Relative mrna level WT htb-k9r brl2!" 2 3 B act Normalized % IP rtf-tap rtf-tap htb-k9r
SUPPLEMENTARY INFORMATION
doi:10.1038/nature11326 Supplementary Figure 1: Histone exchange increases over the ORF in a set2 mutant. (a) Gene average analysis. Schematic representation of the bin distribution over the coding and
More informationSupplemental Information. The E2F functional analog SBF recruits the Rpd3(L) HDAC, via Whi5 and Stb1,
The E2F functional analog SBF recruits the Rpd3(L) HDAC, via Whi5 and Stb1, and the FACT chromatin reorganizer, to yeast G1 cyclin promoters Shinya Takahata, Yaxin Yu, and David J. Stillman Supplemental
More informationJung-Nam Cho, Jee-Youn Ryu, Young-Min Jeong, Jihye Park, Ji-Joon Song, Richard M. Amasino, Bosl Noh, and Yoo-Sun Noh
Developmental Cell, Volume 22 Supplemental Information Control of Seed Germination by Light-Induced Histone Arginine Demethylation Activity Jung-Nam Cho, Jee-Youn Ryu, Young-Min Jeong, Jihye Park, Ji-Joon
More informationSeparation of a functional deubiquitylating module from the SAGA complex by the proteasome regulatory particle
Supplementary information for Separation of a functional deubiquitylating module from the SAGA complex by the proteasome regulatory particle Sungsu Lim 1, Jaechan Kwak 1, Minhoo Kim 1 and Daeyoup Lee 1,*
More informationChampionChIP Quick, High Throughput Chromatin Immunoprecipitation Assay System
ChampionChIP Quick, High Throughput Chromatin Immunoprecipitation Assay System Liyan Pang, Ph.D. Application Scientist 1 Topics to be Covered Introduction What is ChIP-qPCR? Challenges Facing Biological
More informationSupplementary Figure 1. jmj30-2 and jmj32-1 produce null mutants. (a) Schematic drawing of JMJ30 and JMJ32 genome structure showing regions amplified
Supplementary Figure 1. jmj30-2 and jmj32-1 produce null mutants. (a) Schematic drawing of JMJ30 and JMJ32 genome structure showing regions amplified by primers used for mrna expression analysis. Gray
More informationSupplemental Data. Sethi et al. (2014). Plant Cell /tpc
Supplemental Data Supplemental Figure 1. MYC2 Binds to the E-box but not the E1-box of the MPK6 Promoter. (A) E1-box and E-box (wild type) containing MPK6 promoter fragment. The region shown in red denotes
More informationSUPPLEMENTAL FIGURES AND TABLES
SUPPLEMENTAL FIGURES AND TABLES A B Flag-ALDH1A1 IP: α-ac HEK293T WT 91R 128R 252Q 367R 41/ 419R 435R 495R 412R C Flag-ALDH1A1 NAM IP: HEK293T + + - + D NAM - + + E Relative ALDH1A1 activity 1..8.6.4.2
More informationABSTRACT. Yufeng Gou. target genes, and they are responsible for stem cell differentiation and
ABSTRACT Identification of a novel PRC2 recruiter in mammalian cells by Yufeng Gou Polycomb repressive complex (PRC) 2 functions to repress thousands of target genes, and they are responsible for stem
More informationsupplementary information
supplementary information Figure S1 (a) Alignment of the Sgf11 amino acid sequences from S. cerevisiae, Yarrowia lipolytica and S. pombe with Sgf73 sequences from S. cerevisiae, S. pombe and Candida albicans.
More informationT H E J O U R N A L O F C E L L B I O L O G Y
T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Han et al., http://www.jcb.org/cgi/content/full/jcb.201311007/dc1 Figure S1. SIVA1 interacts with PCNA. (A) HEK293T cells were transiently
More informationHPV E6 oncoprotein targets histone methyltransferases for modulating specific. Chih-Hung Hsu, Kai-Lin Peng, Hua-Ci Jhang, Chia-Hui Lin, Shwu-Yuan Wu,
1 HPV E oncoprotein targets histone methyltransferases for modulating specific gene transcription 3 5 Chih-Hung Hsu, Kai-Lin Peng, Hua-Ci Jhang, Chia-Hui Lin, Shwu-Yuan Wu, Cheng-Ming Chiang, Sheng-Chung
More informationsupplementary information
DOI: 10.1038/ncb2007 Figure S1 Temperature sensitivity of DNA ligase I alleles. a, SSL204 (CDC9), SSL612 (cdc9-1) and SSL613 (cdc9-2) cells were spotted in ten-fold serial dilutions on YPD plates and incubated
More informationSUPPLEMENTARY MATERIALS
SUPPLEMENTARY MATERIALS SUPPLEMENTARY FIGURE LEGENDS Supplementary Figure 1 Condensin is required for condensation of rdna array during starvation (A) Loss of condensin blocks rdna condensation during
More informationSupplemental Figure 1 (Figure S1), related to Figure 1 Figure S1 provides evidence to demonstrate Nfatc1Cre is a mouse line that directed gene
Developmental Cell, Volume 25 Supplemental Information Brg1 Governs a Positive Feedback Circuit in the Hair Follicle for Tissue Regeneration and Repair Yiqin Xiong, Wei Li, Ching Shang, Richard M. Chen,
More informationChIP grade antibodies: selection and validation. Rachel Imoberdorf, PhD Senior Development Scientist
ChIP grade antibodies: selection and validation Rachel Imoberdorf, PhD Senior Development Scientist Introduction Antibody selection Antibody validation ChIP at www.abcam.com Introduction Chromatin Immunoprecipitation
More informationSupplementary Fig S1 Nutlin-3a treatment does not affect cell cycle progression in the absence
Supplementary Figure Legends Supplementary Fig S1 Nutlin-3a treatment does not affect cell cycle progression in the absence of p53 or p21. HCT116 cells which were null for either p53 (A) or p21 (B) were
More informationSupplementary information for. Dxo1 is a novel eukaryotic enzyme with both decapping. Columbia University. New York, NY10027, USA. Rutgers University
Supplementary information for Dxo1 is a novel eukaryotic enzyme with both decapping and 5ʹ -3ʹ exoribonuclease activities Jeong-Ho Chang, 1,3 Xinfu Jiao, 2,3 Kunitoshi Chiba, 1 ChanSeok Oh, 2 Charles E.
More informationNature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1
Supplementary Figure 1 Detection of MCM-subunit SUMOylation under normal growth conditions. a. Sumoylated forms of MCM subunits show differential shifts when SUMO is attached to differently sized tags.
More informationGene Forward Primer Reverse Primer GAPDH ATCATCCCTGCCTCTACTGG GTCAGGTCCACCACTGACAC SSB1 AACTTCAGTGAGCCAAACCC GTTCTCAGAGGCTGGAGAGG
Supplemental Data EXPERIMENTAL PROCEDURES Plasmids and Antibodies- Full length cdna of INT11 or INT12 were cloned into ps- Flag-SBP vector respectively. Anti-RNA pol II (RPB1) was purchased from Santa
More informationNature Genetics: doi: /ng.3556 INTEGRATED SUPPLEMENTARY FIGURE TEMPLATE. Supplementary Figure 1
INTEGRATED SUPPLEMENTARY FIGURE TEMPLATE Supplementary Figure 1 REF6 expression in transgenic lines. (a,b) Expression of REF6 in REF6-HA ref6 and REF6ΔZnF-HA ref6 plants detected by RT qpcr (a) and immunoblot
More informationSupplemental discussion
SUPPLEMENTARY INFORMATION doi:10.1038/nature09574 Supplemental discussion The finding that PRC1 binds to nucleosomes relatively stable has been previously published 1-3. Indeed, it has been shown that
More informationSUPPLEMENTAL MATERIAL. Carvajal et al. Supplemental Table 1. List of quantitative PCR primers used for cdna analyses and
UPPLEMEAL MATERIAL Carvajal et al. upplemental Table 1. List of quantitative PCR primers used for cdna analyses and chromatin immunoprecipitation assays. Figure 1. DNA damage-induced transcriptional repression
More informationSupplemental Figure 1 HDA18 has an HDAC domain and therefore has concentration dependent and TSA inhibited histone deacetylase activity.
Supplemental Figure 1 HDA18 has an HDAC domain and therefore has concentration dependent and TSA inhibited histone deacetylase activity. (A) Amino acid alignment of HDA5, HDA15 and HDA18. The blue line
More informationSupplemental Data. Genome-Wide Dynamics of Htz1, a Histone H2A. Variant that Poises Repressed/Basal Promoters. for Activation through Histone Loss
Supplemental Data Genome-Wide Dynamics of Htz1, a Histone H2A Variant that Poises Repressed/Basal Promoters for Activation through Histone Loss Haiying Zhang, Douglas N. Roberts, and Bradley R. Cairns
More informationAt E17.5, the embryos were rinsed in phosphate-buffered saline (PBS) and immersed in
Supplementary Materials and Methods Barrier function assays At E17.5, the embryos were rinsed in phosphate-buffered saline (PBS) and immersed in acidic X-gal mix (100 mm phosphate buffer at ph4.3, 3 mm
More informationSupporting Information
Supporting Information Chandrasekharan et al..73/pnas.978626 SI Text Western Blot Analysis. Whole cell extracts (WCEs) were prepared using a procedure described by Gardner et al. () with modifications.
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION Supplementary figures Supplementary Figure 1: Suv39h1, but not Suv39h2, promotes HP1α sumoylation in vivo. In vivo HP1α sumoylation assay. Top: experimental scheme. Middle: we
More informationPhosphorylation of RNA polymerase CTD dictates transcription
Supplementary Information Phosphorylation of RNA polymerase CTD dictates transcription termination choice Rajani Kanth Gudipati 1,2,3, Tommaso Villa 1,2,3, Jocelyne Boulay 1,2 and Domenico Libri 1,2. 1
More informationSUPPLEMENTARY INFORMATION
(Supplementary Methods and Materials) GST pull-down assay GST-fusion proteins Fe65 365-533, and Fe65 538-700 were expressed in BL21 bacterial cells and purified with glutathione-agarose beads (Sigma).
More informationH3K36me3 polyclonal antibody
H3K36me3 polyclonal antibody Cat. No. C15410192 Type: Polyclonal ChIP-grade/ChIP-seq grade Source: Rabbit Lot #: A1845P Size: 50 µg/32 µl Concentration: 1.6 μg/μl Specificity: Human, mouse, Arabidopsis,
More informationSupplementary Figure 1. Chromosome 3 is devoid of the telomere-proximal subtelomeric
Supplementary Figure 1. Chromosome 3 is devoid of the telomere-proximal subtelomeric common sequences. (a) Schematic illustration of the telomere-proximal site of subtelomeres. The restriction map is based
More informationEPIGENTEK. EpiQuik Chromatin Immunoprecipitation Kit. Base Catalog # P-2002 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE
EpiQuik Chromatin Immunoprecipitation Kit Base Catalog # P-2002 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE The EpiQuik Chromatin Immunoprecipitation Kit is suitable for combining the specificity of
More informationTechnical Review. Real time PCR
Technical Review Real time PCR Normal PCR: Analyze with agarose gel Normal PCR vs Real time PCR Real-time PCR, also known as quantitative PCR (qpcr) or kinetic PCR Key feature: Used to amplify and simultaneously
More informationSupplemental Materials and Methods. Yeast strains. Strain genotypes are listed in Table S1. To generate MATainc::LEU2,
Supplemental Materials and Methods Yeast strains. Strain genotypes are listed in Table S1. To generate MATainc::LEU2, the LEU2 marker was inserted by PCR-mediated recombination (BRACHMANN et al. 1998)
More informationMolecular mechanisms and epigenetic regulation of adenovirus genome structure in persistent infection
MSc MOL BIOTECH 12 003 Molecular mechanisms and epigenetic regulation of adenovirus genome structure in persistent infection Sibel Ciftci Degree project in molecular biotechnology, 2012 Examensarbete i
More informationSupplemental Data. Zhang et al. Plant Cell (2014) /tpc
Supplemental Data. Zhang et al. Plant Cell (214) 1.115/tpc.114.134163 55 - T C N SDIRIP1-GFP 35-25 - Psb 18 - Histone H3 Supplemental Figure 1. Detection of SDIRIP1-GFP in the nuclear fraction by Western
More informationFigure S1. sporulation frequency (%) 80. sme2-5. sme2-3. sme2
Figure S1 N WT -5-3 - DSRless mei4 100 ssm4 MS2loop () (kb) 1.0 0.5 sporulation frequency (%) 80 60 40 20 rrna 1 2 3 4 5 6 7 8 0 WT -5-3 -DSRless Figure S1. The DSR motifs in are crucial for its function.
More informationSupplemental Data. Cui et al. (2012). Plant Cell /tpc a b c d. Stem UBC32 ACTIN
A Root Stem Leaf Flower Silique Senescence leaf B a b c d UBC32 ACTIN C * Supplemental Figure 1. Expression Pattern and Protein Sequence of UBC32 Homologues in Yeast, Human, and Arabidopsis. (A) Expression
More informationChromatin immunoprecipitation (ChIP) ES and FACS-sorted GFP+/Flk1+ cells were fixed in 1% formaldehyde and sonicated until fragments of an average
Chromatin immunoprecipitation (ChIP) ES and FACS-sorted cells were fixed in % formaldehyde and sonicated until fragments of an average size of 5 bp were obtained. Soluble, sheared chromatin was diluted
More informationSupplemental Materials and Methods
Supplemental Materials and Methods Co-immunoprecipitation (Co-IP) assay Cells were lysed with NETN buffer (20 mm Tris-HCl, ph 8.0, 0 mm NaCl, 1 mm EDT, 0.5% Nonidet P-40) containing 50 mm β-glycerophosphate,
More informationSupplementary Information
Supplementary Information Table of contents: Pages: Supplementary Methods 2-3 Supplementary Figure 1 4 Supplementary Figure 2 5 Supplementary Figure 3 6 Supplementary Figure 4 7 Supplementary Figure 5
More informationSupplementary Figure legends
Supplementary Figure legends Figure S. Histone shuffle strain construction and characterization. A. Schematic representing the histone shuffle strain. Both genomic copies of the and genes are deleted (genes
More informationA RRM1 H2AX DAPI. RRM1 H2AX DAPI Merge. Cont. sirna RRM1
A H2AX DAPI H2AX DAPI Merge Cont sirna Figure S1: Accumulation of RRM1 at DNA damage sites (A) HeLa cells were subjected to in situ detergent extraction without IR irradiation, and immunostained with the
More informationExpanded View Figures
MO reports Leo1 Paf1 promotes histone turnover Laia Sadeghi et al xpanded View Figures Figure V1. The transposon mutagenesis system. artoon of the Hermes transposon screen. Southern blot of the Hermes
More informationSupplementary Data. Supplementary Methods Three-step protocol for spontaneous differentiation of mouse induced pluripotent stem (embryonic stem) cells
Supplementary Data Supplementary Methods Three-step protocol for spontaneous differentiation of mouse induced pluripotent stem (embryonic stem) cells Mouse induced pluripotent stem cells (ipscs) were cultured
More informationSupplemental Material Igreja and Izaurralde 1. CUP promotes deadenylation and inhibits decapping of mrna targets. Catia Igreja and Elisa Izaurralde
Supplemental Material Igreja and Izaurralde 1 CUP promotes deadenylation and inhibits decapping of mrna targets Catia Igreja and Elisa Izaurralde Supplemental Materials and methods Functional assays and
More informationEPIGENTEK. EpiQuik Tissue Chromatin Immunoprecipitation Kit. Base Catalog # P-2003 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE
EpiQuik Tissue Chromatin Immunoprecipitation Kit Base Catalog # P-2003 PLEASE READ THIS ENTIRE USER GUIDE BEFORE USE The EpiQuik Tissue Chromatin Immunoprecipitation Kit is suitable for combining the specificity
More informationSupplementary Figure S1. Immunodetection of full-length XA21 and the XA21 C-terminal cleavage product.
Supplementary Information Supplementary Figure S1. Immunodetection of full-length XA21 and the XA21 C-terminal cleavage product. Total protein extracted from Kitaake wild type and rice plants carrying
More informationSupplementary Table S1
Primers used in RT-qPCR, ChIP and Bisulphite-Sequencing. Quantitative real-time RT-PCR primers Supplementary Table S1 gene Forward primer sequence Reverse primer sequence Product TRAIL CAACTCCGTCAGCTCGTTAGAAAG
More informationSupplemental materials
Supplemental materials Materials and methods for supplemental figures Yeast two-hybrid assays TAP46-PP2Ac interactions I. The TAP46 was used as the bait and the full-length cdnas of the five C subunits
More informationSupplemental Figure 1.
Supplemental Data. Charron et al. Dynamic landscapes of four histone modifications during de-etiolation in Arabidopsis. Plant Cell (2009). 10.1105/tpc.109.066845 Supplemental Figure 1. Immunodetection
More informationFig. S1. eif6 expression in HEK293 transfected with shrna against eif6 or pcmv-eif6 vector.
Fig. S1. eif6 expression in HEK293 transfected with shrna against eif6 or pcmv-eif6 vector. (a) Western blotting analysis and (b) qpcr analysis of eif6 expression in HEK293 T cells transfected with either
More informationNature Genetics: doi: /ng Supplementary Figure 1. ChIP-seq genome browser views of BRM occupancy at previously identified BRM targets.
Supplementary Figure 1 ChIP-seq genome browser views of BRM occupancy at previously identified BRM targets. Gene structures are shown underneath each panel. Supplementary Figure 2 pref6::ref6-gfp complements
More informationSupplementary Figure 1.
Supplementary Figure 1. Quantification of western blot analysis of fibroblasts (related to Figure 1) (A-F) Quantification of western blot analysis for control and IR-Mut fibroblasts. Data are expressed
More informationSupplementary Information
Supplementary Information MLL histone methylases regulate expression of HDLR- in presence of estrogen and control plasma cholesterol in vivo Khairul I. Ansari 1, Sahba Kasiri 1, Imran Hussain 1, Samara
More information3.1 The Role of the Enzymatic Activity of Sir2 for Efficient. The Sir proteins are recruited to DNA by site-specific DNA-binding proteins and
35 3 RESULTS 3.1 The Role of the Enzymatic Activity of Sir2 for Efficient Association of the SIR Complex with DNA The Sir proteins are recruited to DNA by site-specific DNA-binding proteins and subsequently
More informationFigure S1. nuclear extracts. HeLa cell nuclear extract. Input IgG IP:ORC2 ORC2 ORC2. MCM4 origin. ORC2 occupancy
A nuclear extracts B HeLa cell nuclear extract Figure S1 ORC2 (in kda) 21 132 7 ORC2 Input IgG IP:ORC2 32 ORC C D PRKDC ORC2 occupancy Directed against ORC2 C-terminus (sc-272) MCM origin 2 2 1-1 -1kb
More informationTHE ANALYSIS OF CHROMATIN CONDENSATION STATE AND TRANSCRIPTIONAL ACTIVITY USING DNA MICROARRAYS 1. INTRODUCTION
JOURNAL OF MEDICAL INFORMATICS & TECHNOLOGIES Vol.6/2003, ISSN 1642-6037 Piotr WIDŁAK *, Krzysztof FUJAREWICZ ** DNA microarrays, chromatin, transcription THE ANALYSIS OF CHROMATIN CONDENSATION STATE AND
More informationSupplementary Information
Supplementary Information Supplementary Figure 1: Identification of new regulators of MuSC by a proteome-based shrna screen. (a) FACS plots of GFP + and GFP - cells from Pax7 ICN -Z/EG (upper panel) and
More informationNature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1
Supplementary Figure 1 Endogenous gene tagging to study subcellular localization and chromatin binding. a, b, Schematic of experimental set-up to endogenously tag RNAi factors using the CRISPR Cas9 technology,
More informationA novel tool for monitoring endogenous alpha-synuclein transcription by NanoLuciferase
A novel tool for monitoring endogenous alpha-synuclein transcription by NanoLuciferase tag insertion at the 3 end using CRISPR-Cas9 genome editing technique Sambuddha Basu 1, 3, Levi Adams 1, 3, Subhrangshu
More informationVCP adaptor interactions are exceptionally dynamic and subject to differential modulation by a VCP inhibitor
VCP adaptor interactions are exceptionally dynamic and subject to differential modulation by a VCP inhibitor Liang Xue 1, Emily E. Blythe 1, Elyse C. Freiberger 2, Jennifer Mamrosh 1, Alexander S. Hebert
More informationNature Genetics: doi: /ng Supplementary Figure 1. High-confidence PRC2 targets and candidate PREs.
Supplementary Figure 1 High-confidence PRC2 targets and candidate PREs. (a) Flowchart for identification of candidate Arabidopsis PREs. We identified 1504 genomic regions marked by at least 3 of the following:
More informationRevision Checklist for Science Signaling Research Manuscripts: Data Requirements and Style Guidelines
Revision Checklist for Science Signaling Research Manuscripts: Data Requirements and Style Guidelines Further information can be found at: http://stke.sciencemag.org/sites/default/files/researcharticlerevmsinstructions_0.pdf.
More informationSupporting Information. SI Material and Methods
Supporting Information SI Material and Methods RNA extraction and qrt-pcr RNA extractions were done using the classical phenol-chloroform method. Total RNA samples were treated with Turbo DNA-free (Ambion)
More informationJustin A. Pruneski, Sarah J. Hainer, Kostadin O. Petrov, and Joseph A. Martens*
EUKARYOTIC CELL, Oct. 2011, p. 1283 1294 Vol. 10, No. 10 1535-9778/11/$12.00 doi:10.1128/ec.05141-11 Copyright 2011, American Society for Microbiology. All Rights Reserved. The Paf1 Complex Represses SER3
More informationName Genotype Reference
Supplemental Data Supplemental Table 1 S. cerevisiae strains. Name Genotype Reference RMY200 UKY403 W303-1a MATa ade2-101 (och) his3 200 lys2-801 (amp) trp1 901 ura3-52 hht1,hhf1::leu2 hht2,hhf2::his3
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb3209 Supplementary Figure 1 IR induces the association of FH with chromatin. a, U2OS cells synchronized by thymidine double block (2 mm) underwent no release (G1 phase) or release for 2
More informationSupplemental Data. Jing et al. (2013). Plant Cell /tpc
Supplemental Figure 1. Characterization of epp1 Mutants. (A) Cotyledon angles of 5-d-old Col wild-type (gray bars) and epp1-1 (black bars) seedlings under red (R), far-red (FR) and blue (BL) light conditions,
More informationSUPPLEMENTARY INFORMATION FILE
SUPPLEMENTARY INFORMATION FILE Existence of a microrna pathway in anucleate platelets Patricia Landry, Isabelle Plante, Dominique L. Ouellet, Marjorie P. Perron, Guy Rousseau & Patrick Provost 1. SUPPLEMENTARY
More informationNature Biotechnology: doi: /nbt Supplementary Figure 1. In vitro validation of OTC sgrnas and donor template.
Supplementary Figure 1 In vitro validation of OTC sgrnas and donor template. (a) In vitro validation of sgrnas targeted to OTC in the MC57G mouse cell line by transient transfection followed by 4-day puromycin
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION DOI: 1.138/NMAT3777 Biophysical regulation of epigenetic state and cell reprogramming Authors: Timothy L. Downing 1,2, Jennifer Soto 1,2, Constant Morez 2,3,, Timothee Houssin
More informationadministration of tamoxifen. Bars show mean ± s.e.m (n=10-11). P-value was determined by
Supplementary Figure 1. Chimerism of CD45.2 + GFP + cells at 1 month post transplantation No significant changes were detected in chimerism of CD45.2 + GFP + cells between recipient mice repopulated with
More informationSUPPLEMENTARY INFORMATION. LIN-28 co-transcriptionally binds primary let-7 to regulate mirna maturation in C. elegans
SUPPLEMENTARY INFORMATION LIN-28 co-transcriptionally binds primary let-7 to regulate mirna maturation in C. elegans Priscilla M. Van Wynsberghe 1, Zoya S. Kai 1, Katlin B. Massirer 2-4, Victoria H. Burton
More informationS156AT168AY175A (AAA) were purified as GST-fusion proteins and incubated with GSTfused
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 Supplemental Materials Supplemental Figure S1 (a) Phenotype of the wild type and grik1-2 grik2-1 plants after 8 days in darkness.
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature11355 Supplemental Table 1. Gene targeting efficiency in mutants of nonessential genes. This table is presented as a separate Excel file. Supplemental Table 2. Genes with altered expression
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature12119 SUPPLEMENTARY FIGURES AND LEGENDS pre-let-7a- 1 +14U pre-let-7a- 1 Ddx3x Dhx30 Dis3l2 Elavl1 Ggt5 Hnrnph 2 Osbpl5 Puf60 Rnpc3 Rpl7 Sf3b3 Sf3b4 Tia1 Triobp U2af1 U2af2 1 6 2 4 3
More informationSUPPLEMENTARY INFORMATION
doi: 1.138/nature7652 Supplementary Figure legends Figure 1. Diagrammatic representation of the rdna locus on yeast chromosome XII and the processing pathway from 35S full length nascent rrna to mature
More informationRegulation of transcription by the MLL2 complex and MLL complex-associated AKAP95
Supplementary Information Regulation of transcription by the complex and MLL complex-associated Hao Jiang, Xiangdong Lu, Miho Shimada, Yali Dou, Zhanyun Tang, and Robert G. Roeder Input HeLa NE IP lot:
More informationQuantitative and non-quantitative RT-PCR. cdna was generated from 500ng RNA (iscript;
Supplemental Methods Quantitative and non-quantitative RT-PCR. cdna was generated from 500ng RNA (iscript; Bio-Rad, Hercules, CA, USA) and standard RT-PCR experiments were carried out using the 2X GoTaq
More informationAlternative Cleavage and Polyadenylation of RNA
Developmental Cell 18 Supplemental Information The Spen Family Protein FPA Controls Alternative Cleavage and Polyadenylation of RNA Csaba Hornyik, Lionel C. Terzi, and Gordon G. Simpson Figure S1, related
More informationRegulation of ARE transcript 3 end processing by the. yeast Cth2 mrna decay factor
Regulation of ARE transcript 3 end processing by the yeast Cth2 mrna decay factor Manoël Prouteau, Marie-Claire Daugeron and Bertrand Séraphin Supplementary Information Material and Methods Plasmid construction
More informationSupplementary data. sienigma. F-Enigma F-EnigmaSM. a-p53
Supplementary data Supplemental Figure 1 A sienigma #2 sienigma sicontrol a-enigma - + ++ - - - - - - + ++ - - - - - - ++ B sienigma F-Enigma F-EnigmaSM a-flag HLK3 cells - - - + ++ + ++ - + - + + - -
More informationSupplemental Figure 1 Human REEP family of proteins can be divided into two distinct subfamilies. Residues (single letter amino acid code) identical
Supplemental Figure Human REEP family of proteins can be divided into two distinct subfamilies. Residues (single letter amino acid code) identical in all six REEPs are highlighted in green. Additional
More informationHitting the mark: specificity analysis of histone antibodies
APPLICATION NOTE Histone modification antibodies Hitting the mark: specificity analysis of histone antibodies Introduction The nucleosome, composed of the histones H2A, H2B, H3, and H4, is the fundamental
More informationSUPPLEMENTARY INFORMATION
doi:1.138/nature11676 Replication template exchange Ori Rearrangement: acentric and/or dicentric Model for HR-dependent restart Restart on wrong template HJ resolution either restores original Restart
More informationimmunofluorescence. Name of antibodies Manufacturer Catalog Number Rabbit anti-pdyn Rabbit anti-kor-1
Supplemental Tables Table S1. List of primary antibodies used for immunohistochemistry, FACS, and immunofluorescence. Name of antibodies Manufacturer Catalog Number Rabbit anti-pdyn Bioss USA bs-13041r
More informationRNA oligonucleotides and 2 -O-methylated oligonucleotides were synthesized by. 5 AGACACAAACACCAUUGUCACACUCCACAGC; Rand-2 OMe,
Materials and methods Oligonucleotides and DNA constructs RNA oligonucleotides and 2 -O-methylated oligonucleotides were synthesized by Dharmacon Inc. (Lafayette, CO). The sequences were: 122-2 OMe, 5
More informationSupplementary Figure1: ClustalW comparison between Tll, Dsf and NR2E1.
P-Box Dsf -----------------MG-TAG--DRLLD-IPCKVCGDRSSGKHYGIYSCDGCSGFFKR 39 NR2E1 -----------------MSKPAGSTSRILD-IPCKVCGDRSSGKHYGVYACDGCSGFFKR 42 Tll MQSSEGSPDMMDQKYNSVRLSPAASSRILYHVPCKVCRDHSSGKHYGIYACDGCAGFFKR
More informationSupporting Information
Supporting Information Rougemaille et al. 1.173/pnas.12494719 SI Methods Strain Construction. Homologous replacement of DNA was accomplished by lithium acetate transformation of PCR products containing
More informationFigure S1: NUN preparation yields nascent, unadenylated RNA with a different profile from Total RNA.
Summary of Supplemental Information Figure S1: NUN preparation yields nascent, unadenylated RNA with a different profile from Total RNA. Figure S2: rrna removal procedure is effective for clearing out
More informationTo determine the effect of N1IC in the susceptibility of T cells to the tolerogenic effect of tumorassociated
Supplementary Methods Tolerogenic effect of MDSC To determine the effect of N1IC in the susceptibility of T cells to the tolerogenic effect of tumorassociated MDSC in vivo, we used a model described previously
More informationSupplementary Information
Supplementary Information Supplementary Figure 1. ZBTB20 expression in the developing DRG. ZBTB20 expression in the developing DRG was detected by immunohistochemistry using anti-zbtb20 antibody 9A10 on
More informationSchematic representation of the endogenous PALB2 locus and gene-disruption constructs
Supplementary Figures Supplementary Figure 1. Generation of PALB2 -/- and BRCA2 -/- /PALB2 -/- DT40 cells. (A) Schematic representation of the endogenous PALB2 locus and gene-disruption constructs carrying
More informationFigure S1. Replication initiation sites at efficient ORIs do not coincide with nucleosomedepleted
Figure S1. Replication initiation sites at efficient ORIs do not coincide with nucleosomedepleted regions in the mouse genome. Typical examples of SNS profiles (Cayrou et al., 11) and nucleosome occupancies
More informationNature Structural and Molecular Biology: doi: /nsmb Supplementary Figure 1. Validation of CDK9-inhibitor treatment.
Supplementary Figure 1 Validation of CDK9-inhibitor treatment. (a) Schematic of GAPDH with the middle of the amplicons indicated in base pairs. The transcription start site (TSS) and the terminal polyadenylation
More informationNature Immunology: doi: /ni Supplementary Figure 1. Zranb1 gene targeting.
Supplementary Figure 1 Zranb1 gene targeting. (a) Schematic picture of Zranb1 gene targeting using an FRT-LoxP vector, showing the first 6 exons of Zranb1 gene (exons 7-9 are not shown). Targeted mice
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/5/244/ra72/dc1 Supplementary Materials for An Interaction Between BZR1 and DELLAs Mediates Direct Signaling Crosstalk Between Brassinosteroids and Gibberellins
More informationEngineering splicing factors with designed specificities
nature methods Engineering splicing factors with designed specificities Yang Wang, Cheom-Gil Cheong, Traci M Tanaka Hall & Zefeng Wang Supplementary figures and text: Supplementary Figure 1 Supplementary
More information