S156AT168AY175A (AAA) were purified as GST-fusion proteins and incubated with GSTfused

Size: px
Start display at page:

Download "S156AT168AY175A (AAA) were purified as GST-fusion proteins and incubated with GSTfused"

Transcription

1 Supplemental Materials Supplemental Figure S1 (a) Phenotype of the wild type and grik1-2 grik2-1 plants after 8 days in darkness. (b) Recovery of the wild type and grik1-2 grik2-1 after 60h-submergence treatment. Pictures were taken after 4 days of recovery. (c) Phenotype of the wild type and grik1-2 grik2-1 under various sugar supplements. Pictures show seedlings growth on MS plates supplemented with sucrose 1% (control), and with additional 3% glucose, sucrose or sorbitol. Scale bar: 1 cm. The bar graph plots the rates of green seedlings of Col-0 (black bar) and grik1-2 grik2-1 (gray bar) (mean ± SE, n=4). * P<0.001 in t-test. (d) Seedlings of the wild type (Col-0), grik2-1, grik1-2, and grik1-2 grik2-1 mutants grown on MS agar plates were transferred to fresh with or without mannitol. The line graph depicts primary root length of seedlings 12d after transfer to MS agar plates with indicated concentration of mannitol (mean ± S.E., n=20). Supplemental Figure S2 Control experiments for the in vitro kinase assays. (a) In vitro kinase assay as in Figure 3 but without GRIK1 (arrowhead) or SOS2KN (arrow). (b) Coomassie staining of GST-GRIK1 loaded with 10-fold more protein than that in (a) to show its purity. (c) The SOS2 mutant variants S156A (SA), T168A (TA), Y175A (YA) and S156AT168AY175A (AAA) were purified as GST-fusion proteins and incubated with GSTfused GRIK1. Proteins were separated by SDS-PAGE followed by Coomassie staining (left) and autoradiograph (right). (d) In vitro kinase assay as in Figure 6 with or without GRIK1, SOS2-308 (arrowhead) or SOS1-CT (arrows). Note that the small amount of GRIK1 was enough to activate SOS2, even though GRIK1 bands were not observed. Proteins were separated by SDS-PAGE followed 1

2 by Coomassie staining (left) and autoradiograph (right). Supplemental Figure S3 Transgenic lines with similar expression levels of SOS2-S159A (SA), T168A (TA), and Y175A (YA) in the sos2-2 background do not perform as the transgenic lines with wild-type SOS2 in the sos2-2 under salt stress condition. (a) Seedlings grown on MS agar medium were transferred to fresh MS agar plates with 100 mm NaCl. Photographs were taken 12 d after transfer. (b) Northern blot for SOS2 transcript was performed with total RNA extracted from wild type (WT), sos2-2 transgenic plants expressing various mutant forms of SOS2, and sos2-2. RNA was extracted 12h after transfer to MS agar plates with 100 mm NaCl. rrna (ethidium bromide stained) was used as a loading control. Supplemental Figure S4 Decimal dilutions of overnight cultures of the yeast strain YPDahl55 (sak1δ::kanmx elm1δ::kanmx tos3δ::trp1) lacking all three upstream regulatory kinases of SNF1 and expressing the Arabidopsis GRIK1 protein or the dead-kinase mutant K137R were spotted in YP media plates with 2% glucose or a mixture of 2% glycerol and 3% ethanol, and incubated for 2 days. Restoration of growth in non-fermentable carbon sources demonstrated genetic complementation of SAK1, ELM1 and TOS3 absence by the plant GRIK1 kinase. Supplemental Table 1 Primer sequence 2

3

4

5

6

7

8 Supplemental Table 1 Primer sequence GRIK1 cloning point mutation TDNA line identification to check expression forward for pgex4t1 forward for p414gpd reverse pgex4t1forward SOS2 S159A reverse SOS2 T168A reverse SOS2 Y175A reverse GRIK1 K137R reverse pgex4t1 reverse SOS2 S159A forward SOS2 T168A forward SOS2 Y175A forward GRIK1 K137R forward GRIK1-2 LP GRIK1-2 RP GRIK2-1 LP GRIK1-1 RP GRIK1 forward GRIK1 reverse GRIK2 forward GRIK1 reverse tubulin forward tubulin reverse 5'-TAGAATTCATGTTTTGTGATAGTTTTGCATTTGCCC-3' 5'-AAGGATCCACCATGTTTTGTGATAGTTTTGCATTTGC-3' 5'-TACTCGAGTCAGCTATGGTTTTGATCTTCTTCTTCT-3' 5'-GTGGTGGCGACCATCCTCCAA-3' 5'-GCAATGCAGCTAGCCCGAAATCCGAAACCTTCAG-3' 5'-GTTCCACACGTGGCACGCAGAAGTTCTACTCCTTCC-3' 5'-TGGAGCTACAGCGTTCGGAGTTCCACATGTGGTA-3' 5'-AAAAGCCCGGATAGCATAATGCTTGTCATCG-3' 5'-TGTGTCAGAGGTTTTCACCGTC-3' 5'-GGATTTCGGGCTAGCTGCATTGCCTCAGGAAGGAGT-3' 5'-TCTGCGTGCCACGTGTGGAACTCCGAACTATGTAGC-3' 5'-AACTCCGAACGCTGTAGCTCCAGAGGTACTTAGTG-3' 5'-TATGCTATCCGGGCTTTTCACAAGTCACATT-3' 5'-TGGAGTTTCGACATGTTGCGAT-3' 5'-TGGTGATCCAATTTCCAATGAGC-3' 5'-TTTTGGAGCATCCTAACATCG-3' 5'-TGAACCATTGGAGGCTAAAAGA-3' 5'-GGTCTCCTTTGCAAAGATCCA-3' 5'-AAGAATTCAAGAGTCTTCTCAATACATGACCG-3' 5'-GGTCTCCTTTGCAAAGATCCG-3' 5'-AAGAATTCATGACCCCAAGCGAGGTC-3' 5'-TCGTGGATCACAGCAATACA-3' 5'-CCTCCTGCACTTCCACTTCG-3' BiFC GRIK1 forward 5 -CCGCGTGGATCCATGTTTTGTGATAGTTTTG -3 GRIK1 reverse 5 -CGGCGCCCGGGGCTATGGTTTTGATCTTC -3 1

9 RT-PCR T-DNA end forward GRIK1 1 st strand reverse GRIK1 4 th exon reverse 5'-CATTAAAAACGTCCGCAATGTG-3' 5'-TCTCCCGGTACTAGTAACCAG-3' 5'-GAAGAACATCACCCATAGCAG-3' 2

Supplemental Data. Cui et al. (2012). Plant Cell /tpc a b c d. Stem UBC32 ACTIN

Supplemental Data. Cui et al. (2012). Plant Cell /tpc a b c d. Stem UBC32 ACTIN A Root Stem Leaf Flower Silique Senescence leaf B a b c d UBC32 ACTIN C * Supplemental Figure 1. Expression Pattern and Protein Sequence of UBC32 Homologues in Yeast, Human, and Arabidopsis. (A) Expression

More information

Supplemental Data. Wu et al. (2). Plant Cell..5/tpc RGLG Hormonal treatment H2O B RGLG µm ABA µm ACC µm GA Time (hours) µm µm MJ µm IA

Supplemental Data. Wu et al. (2). Plant Cell..5/tpc RGLG Hormonal treatment H2O B RGLG µm ABA µm ACC µm GA Time (hours) µm µm MJ µm IA Supplemental Data. Wu et al. (2). Plant Cell..5/tpc..4. A B Supplemental Figure. Immunoblot analysis verifies the expression of the AD-PP2C and BD-RGLG proteins in the Y2H assay. Total proteins were extracted

More information

Supplemental Data. Sethi et al. (2014). Plant Cell /tpc

Supplemental Data. Sethi et al. (2014). Plant Cell /tpc Supplemental Data Supplemental Figure 1. MYC2 Binds to the E-box but not the E1-box of the MPK6 Promoter. (A) E1-box and E-box (wild type) containing MPK6 promoter fragment. The region shown in red denotes

More information

Supplementary Fig 1. The responses of ERF109 to different hormones and stresses. (a to k) The induced expression of ERF109 in 7-day-old Arabidopsis

Supplementary Fig 1. The responses of ERF109 to different hormones and stresses. (a to k) The induced expression of ERF109 in 7-day-old Arabidopsis Supplementary Fig 1. The responses of ERF109 to different hormones and stresses. (a to k) The induced expression of ERF109 in 7-day-old Arabidopsis seedlings expressing ERF109pro-GUS. The GUS staining

More information

Supplemental Data. Liu et al. (2013). Plant Cell /tpc

Supplemental Data. Liu et al. (2013). Plant Cell /tpc Supplemental Figure 1. The GFP Tag Does Not Disturb the Physiological Functions of WDL3. (A) RT-PCR analysis of WDL3 expression in wild-type, WDL3-GFP, and WDL3 (without the GFP tag) transgenic seedlings.

More information

Supplemental Figure 1. Immunoblot analysis of wild-type and mutant forms of JAZ3

Supplemental Figure 1. Immunoblot analysis of wild-type and mutant forms of JAZ3 Supplemental Data. Chung and Howe (2009). A Critical Role for the TIFY Motif in Repression of Jasmonate Signaling by a Stabilized Splice Variant of the JASMONATE ZIM-domain protein JAZ10 in Arabidopsis.

More information

Alternative Cleavage and Polyadenylation of RNA

Alternative Cleavage and Polyadenylation of RNA Developmental Cell 18 Supplemental Information The Spen Family Protein FPA Controls Alternative Cleavage and Polyadenylation of RNA Csaba Hornyik, Lionel C. Terzi, and Gordon G. Simpson Figure S1, related

More information

Supplemental Data. Na Xu et al. (2016). Plant Cell /tpc

Supplemental Data. Na Xu et al. (2016). Plant Cell /tpc Supplemental Figure 1. The weak fluorescence phenotype is not caused by the mutation in At3g60240. (A) A mutation mapped to the gene At3g60240. Map-based cloning strategy was used to map the mutated site

More information

(phosphatase tensin) domain is shown in dark gray, the FH1 domain in black, and the

(phosphatase tensin) domain is shown in dark gray, the FH1 domain in black, and the Supplemental Figure 1. Predicted Domain Organization of the AFH14 Protein. (A) Schematic representation of the predicted domain organization of AFH14. The PTEN (phosphatase tensin) domain is shown in dark

More information

Supplementary Figure 1 Collision-induced dissociation (CID) mass spectra of peptides from PPK1, PPK2, PPK3 and PPK4 respectively.

Supplementary Figure 1 Collision-induced dissociation (CID) mass spectra of peptides from PPK1, PPK2, PPK3 and PPK4 respectively. Supplementary Figure 1 lision-induced dissociation (CID) mass spectra of peptides from PPK1, PPK, PPK3 and PPK respectively. % of nuclei with signal / field a 5 c ppif3:gus pppk1:gus 0 35 30 5 0 15 10

More information

A Repressor Complex Governs the Integration of

A Repressor Complex Governs the Integration of Developmental Cell 15 Supplemental Data A Repressor Complex Governs the Integration of Flowering Signals in Arabidopsis Dan Li, Chang Liu, Lisha Shen, Yang Wu, Hongyan Chen, Masumi Robertson, Chris A.

More information

Supplemental Figure 1

Supplemental Figure 1 Supplemental Figure 1 A gta2-1 gta2-2 1kb AT4G08350 B Col-0 gta2-1 LP+RP+LBb1.3 C Col-0 gta2-2 LP+RP+LB1 D Col-0 gta2-2 gta2-1 GTA2 TUBLIN E Col0 gta2-1 gta2-2 Supplemental Figure 1. Phenotypic analysis

More information

Supporting Information

Supporting Information Supporting Information Deng et al. 10.1073/pnas.1102117108 Fig. S1. Predicted structure of Arabidopsis bzip60 RNA. Lowest free energy form (ΔG = 309.72 (initially 343.10) of bzip60 mrna folded by M-Fold

More information

Supplemental Data. Furlan et al. Plant Cell (2017) /tpc

Supplemental Data. Furlan et al. Plant Cell (2017) /tpc Supplemental Data. Furlan et al. Plant Cell (0) 0.0/tpc..00. Supplemental Data. Furlan et al. Plant Cell (0) 0.0/tpc..00. Supplemental Data. Furlan et al. Plant Cell (0) 0.0/tpc..00. Supplemental Figure.

More information

Supplemental Data. Benstein et al. (2013). Plant Cell /tpc

Supplemental Data. Benstein et al. (2013). Plant Cell /tpc Supplemental Figure 1. Purification of the heterologously expressed PGDH1, PGDH2 and PGDH3 enzymes by Ni-NTA affinity chromatography. Protein extracts (2 µl) of different fractions (lane 1 = total extract,

More information

Supplementary data. sienigma. F-Enigma F-EnigmaSM. a-p53

Supplementary data. sienigma. F-Enigma F-EnigmaSM. a-p53 Supplementary data Supplemental Figure 1 A sienigma #2 sienigma sicontrol a-enigma - + ++ - - - - - - + ++ - - - - - - ++ B sienigma F-Enigma F-EnigmaSM a-flag HLK3 cells - - - + ++ + ++ - + - + + - -

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION AS-NMD modulates FLM-dependent thermosensory flowering response in Arabidopsis NATURE PLANTS www.nature.com/natureplants 1 Supplementary Figure 1. Genomic sequence of FLM along with the splice sites. Sequencing

More information

Supplemental Data. Lee et al. Plant Cell. (2010) /tpc Supplemental Figure 1. Protein and Gene Structures of DWA1 and DWA2.

Supplemental Data. Lee et al. Plant Cell. (2010) /tpc Supplemental Figure 1. Protein and Gene Structures of DWA1 and DWA2. Supplemental Figure 1. Protein and Gene Structures of DWA1 and DWA2. (A) Protein structures of DWA1 and DWA2. WD40 region was determined based on the NCBI conserved domain databases (B, C) Schematic representation

More information

Supplementary Information

Supplementary Information Supplementary Information MED18 interaction with distinct transcription factors regulates plant immunity, flowering time and responses to hormones Supplementary Figure 1. Diagram showing T-DNA insertion

More information

Supplemental Figure 1.

Supplemental Figure 1. Supplemental Data. Charron et al. Dynamic landscapes of four histone modifications during de-etiolation in Arabidopsis. Plant Cell (2009). 10.1105/tpc.109.066845 Supplemental Figure 1. Immunodetection

More information

Supplementary Figures 1-12

Supplementary Figures 1-12 Supplementary Figures 1-12 Supplementary Figure 1. The specificity of anti-abi1 antibody. Total Proteins extracted from the wild type seedlings or abi1-3 null mutant seedlings were used for immunoblotting

More information

Supplemental Data. Li et al. (2015). Plant Cell /tpc

Supplemental Data. Li et al. (2015). Plant Cell /tpc Supplemental Data Supplemental Figure 1: Characterization of asr3 T-DNA knockout lines and complementation transgenic lines. (A) The scheme of At2G33550 (ASR3) with gray boxes indicating exons and dash

More information

Supplementary information

Supplementary information Supplementary information Supplementary figures Figure S1 Level of mycdet1 protein in DET1 OE-1, OE-2 and OE-3 transgenic lines. Total protein extract from wild type Col0, det1-1 mutant and DET1 OE lines

More information

WiscDsLox485 ATG < > //----- E1 E2 E3 E4 E bp. Col-0 arr7 ARR7 ACTIN7. s of mrna/ng total RNA (x10 3 ) ARR7.

WiscDsLox485 ATG < > //----- E1 E2 E3 E4 E bp. Col-0 arr7 ARR7 ACTIN7. s of mrna/ng total RNA (x10 3 ) ARR7. A WiscDsLox8 ATG < > -9 +0 > ---------//----- E E E E E UTR +9 UTR +0 > 00bp B S D ol-0 arr7 ol-0 arr7 ARR7 ATIN7 D s of mrna/ng total RNA opie 0. ol-0 (x0 ) arr7 ARR7 Supplemental Fig.. Genotyping and

More information

Construction of plant complementation vector and generation of transgenic plants

Construction of plant complementation vector and generation of transgenic plants MATERIAL S AND METHODS Plant materials and growth conditions Arabidopsis ecotype Columbia (Col0) was used for this study. SALK_072009, SALK_076309, and SALK_027645 were obtained from the Arabidopsis Biological

More information

Supplemental Figure 1. VLN5 retains conserved residues at both type 1 and type 2 Ca 2+ -binding

Supplemental Figure 1. VLN5 retains conserved residues at both type 1 and type 2 Ca 2+ -binding Supplemental Figure 1. VLN5 retains conserved residues at both type 1 and type 2 Ca 2+ -binding sites in the G1 domain. Multiple sequence alignment was performed with DNAMAN6.0.40. Secondary structural

More information

Supplemental Data. Hu et al. Plant Cell (2017) /tpc

Supplemental Data. Hu et al. Plant Cell (2017) /tpc 1 2 3 4 Supplemental Figure 1. DNA gel blot analysis of homozygous transgenic plants. (Supports Figure 1.) 5 6 7 8 Rice genomic DNA was digested with the restriction enzymes EcoRⅠ and BamHⅠ. Lanes in the

More information

Figure S1. DELLA Proteins Act as Positive Regulators to Mediate GA-Regulated Anthocyanin

Figure S1. DELLA Proteins Act as Positive Regulators to Mediate GA-Regulated Anthocyanin Supplemental Information Figure S1. DELLA Proteins Act as Positive Regulators to Mediate GA-Regulated Anthocyanin Biosynthesis. (A) Effect of GA on anthocyanin content in WT and ga1-3 seedlings. Mock,

More information

Supplemental Materials

Supplemental Materials Supplemental Materials Flores-Pérez et al., Supplemental Materials, page 1 of 5 Supplemental Figure S1. Pull-down and BiFC controls, and quantitative analyses associated with the BiFC studies. (A) Controls

More information

Supplemental Data. Jing et al. (2013). Plant Cell /tpc

Supplemental Data. Jing et al. (2013). Plant Cell /tpc Supplemental Figure 1. Characterization of epp1 Mutants. (A) Cotyledon angles of 5-d-old Col wild-type (gray bars) and epp1-1 (black bars) seedlings under red (R), far-red (FR) and blue (BL) light conditions,

More information

Supplementary Materials for

Supplementary Materials for www.sciencesignaling.org/cgi/content/full/5/244/ra72/dc1 Supplementary Materials for An Interaction Between BZR1 and DELLAs Mediates Direct Signaling Crosstalk Between Brassinosteroids and Gibberellins

More information

Supplemental Data. Seo et al. (2014). Plant Cell /tpc

Supplemental Data. Seo et al. (2014). Plant Cell /tpc Supplemental Figure 1. Protein alignment of ABD1 from other model organisms. The alignment was performed with H. sapiens DCAF8, M. musculus DCAF8 and O. sativa Os10g0544500. The WD40 domains are underlined.

More information

Supplemental Data. Tilbrook et al. (2016). Plant Cell /tpc

Supplemental Data. Tilbrook et al. (2016). Plant Cell /tpc Supplemental Figure 1. Protein alignment of with. Identical aligned residues highlighted in black and similar and non-similar residues highlighted in grey and white, respectively. Position of Trp residues

More information

Jung-Nam Cho, Jee-Youn Ryu, Young-Min Jeong, Jihye Park, Ji-Joon Song, Richard M. Amasino, Bosl Noh, and Yoo-Sun Noh

Jung-Nam Cho, Jee-Youn Ryu, Young-Min Jeong, Jihye Park, Ji-Joon Song, Richard M. Amasino, Bosl Noh, and Yoo-Sun Noh Developmental Cell, Volume 22 Supplemental Information Control of Seed Germination by Light-Induced Histone Arginine Demethylation Activity Jung-Nam Cho, Jee-Youn Ryu, Young-Min Jeong, Jihye Park, Ji-Joon

More information

pgbkt7 Anti- Myc AH109 strain (KDa) 50

pgbkt7 Anti- Myc AH109 strain (KDa) 50 pgbkt7 (KDa) 50 37 Anti- Myc AH109 strain Supplementary Figure 1. Protein expression of CRN and TDR in yeast. To analyse the protein expression of CRNKD and TDRKD, total proteins extracted from yeast culture

More information

Supplemental Data. Steiner et al. Plant Cell. (2012) /tpc

Supplemental Data. Steiner et al. Plant Cell. (2012) /tpc Supplemental Figure 1. SPY does not interact with free GST. Invitro pull-down assay using E. coli-expressed MBP-SPY and GST, GST-TCP14 and GST-TCP15. MBP-SPY was used as bait and incubated with equal amount

More information

Supplemental materials

Supplemental materials Supplemental materials Materials and methods for supplemental figures Yeast two-hybrid assays TAP46-PP2Ac interactions I. The TAP46 was used as the bait and the full-length cdnas of the five C subunits

More information

Sperm cells are passive cargo of the pollen tube in plant fertilization

Sperm cells are passive cargo of the pollen tube in plant fertilization In the format provided by the authors and unedited. SUPPLEMENTARY INFORMATION VOLUME: 3 ARTICLE NUMBER: 17079 Sperm cells are passive cargo of the pollen tube in plant fertilization Jun Zhang 1, Qingpei

More information

Supplemental Data. Zhang et al. (2010). Plant Cell /tpc

Supplemental Data. Zhang et al. (2010). Plant Cell /tpc Supplemental Figure 1. uvs90 gene cloning The T-DNA insertion in uvs90 was identified using thermal asymmetric interlaced (TAIL)-PCR. Three rounds of amplification were performed; the second (2 nd ) and

More information

Supplemental Figure 1 HDA18 has an HDAC domain and therefore has concentration dependent and TSA inhibited histone deacetylase activity.

Supplemental Figure 1 HDA18 has an HDAC domain and therefore has concentration dependent and TSA inhibited histone deacetylase activity. Supplemental Figure 1 HDA18 has an HDAC domain and therefore has concentration dependent and TSA inhibited histone deacetylase activity. (A) Amino acid alignment of HDA5, HDA15 and HDA18. The blue line

More information

Supplementary Figure 1. jmj30-2 and jmj32-1 produce null mutants. (a) Schematic drawing of JMJ30 and JMJ32 genome structure showing regions amplified

Supplementary Figure 1. jmj30-2 and jmj32-1 produce null mutants. (a) Schematic drawing of JMJ30 and JMJ32 genome structure showing regions amplified Supplementary Figure 1. jmj30-2 and jmj32-1 produce null mutants. (a) Schematic drawing of JMJ30 and JMJ32 genome structure showing regions amplified by primers used for mrna expression analysis. Gray

More information

Candidate region (0.74 Mb) ATC TCT GGG ACT CAT GAG CAG GAG GCT AGC ATC TCT GGG ACT CAT TAG CAG GAG GCT AGC

Candidate region (0.74 Mb) ATC TCT GGG ACT CAT GAG CAG GAG GCT AGC ATC TCT GGG ACT CAT TAG CAG GAG GCT AGC A idm-3 idm-3 B Physical distance (Mb) 4.6 4.86.6 8.4 C Chr.3 Recom. Rate (%) ATG 3.9.9.9 9.74 Candidate region (.74 Mb) n=4 TAA D idm-3 G3T(E4) G4A(W988) WT idm-3 ATC TCT GGG ACT CAT GAG CAG GAG GCT AGC

More information

Figure S1. Figure S2 RT-PCR. qpcr RT-PCR. Northern. IVSwt ΔIVS IVS IVS IVS. NTC mock IVSwt ΔIVS IVS IVS. mock IVSwt ΔIVS

Figure S1. Figure S2 RT-PCR. qpcr RT-PCR. Northern. IVSwt ΔIVS IVS IVS IVS. NTC mock IVSwt ΔIVS IVS IVS. mock IVSwt ΔIVS Figure S1 40 cycles IVS IVS IVS NTC wt Δ Δ mut pri-mirna163 * Fig. S1 Transcripts generated from the MIR163 gene variants in which splice sites have been mutated are not spliced. products were separated

More information

Supplemental Data. Wang et al. Plant Cell. (2013) /tpc

Supplemental Data. Wang et al. Plant Cell. (2013) /tpc SNL1 SNL Supplemental Figure 1. The Expression Patterns of SNL1 and SNL in Different Tissues of Arabidopsis from Genevestigator Web Site (https://www.genevestigator.com/gv/index.jsp). 1 A 1. 1..8.6.4..

More information

AD BD TOC1. Supplementary Figure 1: Yeast two-hybrid assays showing the interaction between

AD BD TOC1. Supplementary Figure 1: Yeast two-hybrid assays showing the interaction between AD X BD TOC1 AD BD X PIFΔAD PIF TOC1 TOC1 PIFΔAD PIF N TOC1 TOC1 C1 PIFΔAD PIF C1 TOC1 TOC1 C PIFΔAD PIF C TOC1 Supplementary Figure 1: Yeast two-hybrid assays showing the interaction between PIF and TOC1

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Secondary mutations as a mechanism of cisplatin resistance in BRCA2-mutated cancers Wataru Sakai, Elizabeth M. Swisher, Beth Y. Karlan, Mukesh K. Agarwal, Jake Higgins, Cynthia Friedman, Emily Villegas,

More information

Supplemental Figure 1. Alignment of the NbGAPC amino acid sequences with their Arabidopsis homologues.

Supplemental Figure 1. Alignment of the NbGAPC amino acid sequences with their Arabidopsis homologues. Supplemental Figure 1. Alignment of the NbGAPC amino acid sequences with their Arabidopsis homologues. Homologs from N. benthamiana (NbGAPC1, NbGAPC2, NbGAPC3), Arabidopsis (AtGAPC1, AT3G04120; AtGAPC2,

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION doi:10.1038/nature12119 SUPPLEMENTARY FIGURES AND LEGENDS pre-let-7a- 1 +14U pre-let-7a- 1 Ddx3x Dhx30 Dis3l2 Elavl1 Ggt5 Hnrnph 2 Osbpl5 Puf60 Rnpc3 Rpl7 Sf3b3 Sf3b4 Tia1 Triobp U2af1 U2af2 1 6 2 4 3

More information

AD-FIL AD-YAB2 -2 BD-JAZ3 AD-YAB3 AD-YAB5 AD-FIL -4 3AT BD-JAZ3 AD-YAB3

AD-FIL AD-YAB2 -2 BD-JAZ3 AD-YAB3 AD-YAB5 AD-FIL -4 3AT BD-JAZ3 AD-YAB3 3 4 9 10 11 12 AD-FIL AD-YAB5 2 B AD-YAB3 1 BD-JAZ 5 6 7 8 AD-FIL A AD-YAB2 Supplemental Data. Boter et al. (2015). Plant Cell 10.1105/tpc.15.00220 BD AD-YAB2-2 -2 BD-JAZ3 AD-YAB3 BD AD-YAB5-4 AD-FIL -4

More information

Enhancers mutations that make the original mutant phenotype more extreme. Suppressors mutations that make the original mutant phenotype less extreme

Enhancers mutations that make the original mutant phenotype more extreme. Suppressors mutations that make the original mutant phenotype less extreme Interactomics and Proteomics 1. Interactomics The field of interactomics is concerned with interactions between genes or proteins. They can be genetic interactions, in which two genes are involved in the

More information

Supplemental Materials

Supplemental Materials Supplemental Materials Supplemental Figure S. Phenotypic assessment of alb4 mutant plants under different stress conditions. (A) High-light stress and drought stress. Wild-type (WT) and alb4 mutant plants

More information

Supplemental Data. Farmer et al. (2010) Plant Cell /tpc

Supplemental Data. Farmer et al. (2010) Plant Cell /tpc Supplemental Figure 1. Amino acid sequence comparison of RAD23 proteins. Identical and similar residues are shown in the black and gray boxes, respectively. Dots denote gaps. The sequence of plant Ub is

More information

Supplemental Figure legends Figure S1. (A) (B) (C) (D) Figure S2. Figure S3. (A-E) Figure S4. Figure S5. (A, C, E, G, I) (B, D, F, H, Figure S6.

Supplemental Figure legends Figure S1. (A) (B) (C) (D) Figure S2. Figure S3. (A-E) Figure S4. Figure S5. (A, C, E, G, I) (B, D, F, H, Figure S6. Supplemental Figure legends Figure S1. Map-based cloning and complementation testing for ZOP1. (A) ZOP1 was mapped to a ~273-kb interval on Chromosome 1. In the interval, a single-nucleotide G to A substitution

More information

Supplementary Materials: 1. Supplementary Figures S1-S9. 2. Supplementary Tables S1-S2

Supplementary Materials: 1. Supplementary Figures S1-S9. 2. Supplementary Tables S1-S2 Supplementary Materials: 1. Supplementary Figures S1-S9 2. Supplementary Tables S1-S2 S1 1. Supplementary Figures Fig. S1. Genotypes of tcp20 mutants. Fig. S2. Root phenotypes of tcp20 mutants. Fig. S3.

More information

Supplementary Figure 1. BES1 specifically inhibits ABA responses in early seedling

Supplementary Figure 1. BES1 specifically inhibits ABA responses in early seedling Supplementary Figure 1. BES1 specifically inhibits ABA responses in early seedling development. a. Exogenous BR application overcomes the hypersensitivity of bzr1-1d seedlings to ABA. Seed germination

More information

GTTCGGGTTCC TTTTGAGCAG

GTTCGGGTTCC TTTTGAGCAG Supplementary Figures Splice variants of the SIP1 transcripts play a role in nodule organogenesis in Lotus japonicus. Wang C, Zhu H, Jin L, Chen T, Wang L, Kang H, Hong Z, Zhang Z. 5 UTR CDS 3 UTR TCTCAACCATCCTTTGTCTGCTTCCGCCGCATGGGTGAGGTCATTTTGTCTAGATGACGTGCAATTTACAATGA

More information

Supplementary Figure 1 PZA inhibits root hair formation as well as cell elongation in the maturation zone of eto1-2 roots. (A) The PI staining of the

Supplementary Figure 1 PZA inhibits root hair formation as well as cell elongation in the maturation zone of eto1-2 roots. (A) The PI staining of the Supplementary Figure 1 PZA inhibits root hair formation as well as cell elongation in the maturation zone of eto1-2 roots. (A) The PI staining of the roots of three-day-old etiolated seedlings of Col-0

More information

Supplemental Figure 1

Supplemental Figure 1 Supplemental Figure 1 A LK sls1 lks1-2 F 1 sls1 B LK sls1 lks1-2 F 1 lks1-2 sls1 F 1 lks1-2 sls1 F 2 Col lks1-2 Col+LKS1 Col Col+LKS1 Supplemental Figure 1. Genetic analysis of sls1 mutant. (A) and (B)

More information

Abcam.com. hutton.ac.uk. Ipmdss.dk. Bo Gong and Eva Chou

Abcam.com. hutton.ac.uk. Ipmdss.dk. Bo Gong and Eva Chou Abcam.com Bo Gong and Eva Chou Ipmdss.dk hutton.ac.uk What is a homeotic gene? A gene which regulates the developmental fate of anatomical structures in an organism Why study them? Understand the underlying

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI: 10.1038/ncb3240 Supplementary Figure 1 GBM cell lines display similar levels of p100 to p52 processing but respond differentially to TWEAK-induced TERT expression according to TERT promoter mutation

More information

Experimental Tools and Resources Available in Arabidopsis. Manish Raizada, University of Guelph, Canada

Experimental Tools and Resources Available in Arabidopsis. Manish Raizada, University of Guelph, Canada Experimental Tools and Resources Available in Arabidopsis Manish Raizada, University of Guelph, Canada Community website: The Arabidopsis Information Resource (TAIR) at http://www.arabidopsis.org Can order

More information

Fig. S1. Clustering analysis of expression array and ChIP-PCR assay in the ARF3 locus. (A) Typical examples of the transgenic plants used for

Fig. S1. Clustering analysis of expression array and ChIP-PCR assay in the ARF3 locus. (A) Typical examples of the transgenic plants used for Fig. S1. Clustering analysis of expression array and ChIP-PCR assay in the ARF3 locus. (A) Typical examples of the transgenic plants used for ChIP-chip and ChIP-PCR assays. The presence of pas1:t7:as1

More information

Supplemental data. Zhao et al. (2009). The Wuschel-related homeobox gene WOX11 is required to activate shoot-borne crown root development in rice.

Supplemental data. Zhao et al. (2009). The Wuschel-related homeobox gene WOX11 is required to activate shoot-borne crown root development in rice. Supplemental data. Zhao et al. (2009). The Wuschel-related homeobox gene WOX11 is required to activate shoot-borne crown root development in rice. A B Supplemental Figure 1. Expression of WOX11p-GUS WOX11-GFP

More information

Supplemental Data. Borg et al. Plant Cell (2014) /tpc

Supplemental Data. Borg et al. Plant Cell (2014) /tpc Supplementary Figure 1 - Alignment of selected angiosperm DAZ1 and DAZ2 homologs Multiple sequence alignment of selected DAZ1 and DAZ2 homologs. A consensus sequence built using default parameters is shown

More information

Supplemental Data. Zhang et al. Plant Cell (2014) /tpc

Supplemental Data. Zhang et al. Plant Cell (2014) /tpc Supplemental Data. Zhang et al. Plant Cell (214) 1.115/tpc.114.134163 55 - T C N SDIRIP1-GFP 35-25 - Psb 18 - Histone H3 Supplemental Figure 1. Detection of SDIRIP1-GFP in the nuclear fraction by Western

More information

*** *** * *** *** *** * *** ** ***

*** *** * *** *** *** * *** ** *** Figure S: OsMADS6 over- or down-expression is stable across generations A, OsMADS6 expression in overexpressing (OX, OX, dark bars) and corresponding control (OX, WT, white bars) T4 plants. B, OsMADS6

More information

Supplemental Data. Osakabe et al. (2013). Plant Cell /tpc

Supplemental Data. Osakabe et al. (2013). Plant Cell /tpc Supplemental Figure 1. Phylogenetic analysis of KUP in various species. The amino acid sequences of KUPs from green algae and land plants were identified with a BLAST search and aligned using ClustalW

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION R2A MASNSEKNPLL-SDEKPKSTEENKSS-KPESASGSSTSSAMP---GLNFNAFDFSNMASIL 56 R2B MASSSEKTPLIPSDEKNDTKEESKSTTKPESGSGAPPSPS-PTDPGLDFNAFDFSGMAGIL 60 R2A NDPSIREMAEQIAKDPAFNQLAEQLQRSIPNAGQEGGFPNFDPQQYVNTMQQVMHNPEFK

More information

AGATCCACTAGTTCTAGAGCTCAACTTGTTGGTTTGTCTTT TGTCCAAAAACGGTTTCCAG TGCCTTTCTGTTCGATTGAT

AGATCCACTAGTTCTAGAGCTCAACTTGTTGGTTTGTCTTT TGTCCAAAAACGGTTTCCAG TGCCTTTCTGTTCGATTGAT 1 Table S1. PCR primers Primer Use Sequence (5 3 ) JC17 SAT1 flipper GGCCCCCCCTCGAGGAAGTT JC18 SAT1 flipper GCTCTAGAACTAGTGGATCT JC57 5 NCR of CNA1 AATGATGGAGTTTATGGGAA JC58 5 NCR of CNA1 AACTTCCTCGAGGGGGGGCCGAAAAAAAAAAAGGGGGGGG

More information

DAY 1 DAY 2 DAY 3. GUS activity. Time h (ZT) Cluster 1. Cluster 2 Cluster 3. Cluster 4. Cluster 5. Cluster 6

DAY 1 DAY 2 DAY 3. GUS activity. Time h (ZT) Cluster 1. Cluster 2 Cluster 3. Cluster 4. Cluster 5. Cluster 6 Supplemental Data. Giraud et al. (21). Plant Cell 1.115/tpc.11.74518 A) B) 6 5 4 3 2 1 DAY 1 2 15 1 5 IP SITE II DAY 2 7 6 5 4 3 2 1 IP SITE II DAY 3 IP SITE II ealtive transcript abundance 12 1 75 5 25

More information

Supplemental Data. Meng et al. (2011). Plant Cell /tpc B73 CML311 CML436. Gaspé Flint

Supplemental Data. Meng et al. (2011). Plant Cell /tpc B73 CML311 CML436. Gaspé Flint Gaspé Flint B73 CML311 CML436 A B C D 10 th leaf 10 th leaf 10 th leaf Supplemental Figure 1. Whole plant images of the four varieties used in this study (A) Extreme early flowering temperate line Gaspé

More information

Supplementary information, Figure S1

Supplementary information, Figure S1 Supplementary information, Figure S1 (A) Schematic diagram of the sgrna and hspcas9 expression cassettes in a single binary vector designed for Agrobacterium-mediated stable transformation of Arabidopsis

More information

A Nucleus-Encoded Chloroplast Protein YL1 Is Involved in Chloroplast. Development and Efficient Biogenesis of Chloroplast ATP Synthase in Rice

A Nucleus-Encoded Chloroplast Protein YL1 Is Involved in Chloroplast. Development and Efficient Biogenesis of Chloroplast ATP Synthase in Rice A Nucleus-Encoded Chloroplast Protein YL1 Is Involved in Chloroplast Development and Efficient Biogenesis of Chloroplast ATP Synthase in Rice Fei Chen 1,*, Guojun Dong 2,*, Limin Wu 1, Fang Wang 3, Xingzheng

More information

Supplemental Figure S1. Validation of auxin-related gene expression from Fig. 1A. Relative gene expression in 2x and 3x seeds 6 days after

Supplemental Figure S1. Validation of auxin-related gene expression from Fig. 1A. Relative gene expression in 2x and 3x seeds 6 days after Supplemental Figure S1. Validation of auxin-related gene expression from Fig. 1A. Relative gene expression in 2x and 3x seeds 6 days after pollination (6 DAP), as determined by RT-qPCR for YUC10 (A), YUC11

More information

Nature Genetics: doi: /ng.3556 INTEGRATED SUPPLEMENTARY FIGURE TEMPLATE. Supplementary Figure 1

Nature Genetics: doi: /ng.3556 INTEGRATED SUPPLEMENTARY FIGURE TEMPLATE. Supplementary Figure 1 INTEGRATED SUPPLEMENTARY FIGURE TEMPLATE Supplementary Figure 1 REF6 expression in transgenic lines. (a,b) Expression of REF6 in REF6-HA ref6 and REF6ΔZnF-HA ref6 plants detected by RT qpcr (a) and immunoblot

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION DOI:.38/ncb54 sensitivity (+/-) 3 det- WS bri-5 BL (nm) bzr-dbri- bzr-d/ bri- g h i a b c d e f Hypcocotyl length(cm) 5 5 PAC Hypocotyl length (cm)..8..4. 5 5 PPZ - - + + + + - + - + - + PPZ - - + + +

More information

Supplemental Figure 1. Rosette Leaf Morphology of Single, Double and Triple Mutants of eid3, phya-201 and phyb-5. Photographs of Ler wild type,

Supplemental Figure 1. Rosette Leaf Morphology of Single, Double and Triple Mutants of eid3, phya-201 and phyb-5. Photographs of Ler wild type, Supplemental Figure 1. Rosette Leaf Morphology of Single, Double and Triple Mutants of eid3, phya-201 and phyb-5. Photographs of Ler wild type, phya-201, phyb-5, phya-201 phyb-5, eid3, phya-201 eid3, phyb-5

More information

Supplemental Experimental Procedures

Supplemental Experimental Procedures Supplemental Experimental Procedures Generation of BLM protein segments and mutants. For immunoprecipitation experiments with topoisomerase IIα, BLM N-terminal segments were generated by PCR amplification

More information

Supplementary Materials

Supplementary Materials Supplementary Materials Table S1. Oligonucleotide sequences and PCR conditions used to amplify the indicated genes. TA = annealing temperature; gdna = genomic DNA; cdna = complementary DNA; c = concentration.

More information

Gene specific primers. Left border primer (638) ala3-4 (Salk_082157) Gene specific primers. Left border primer (1343)

Gene specific primers. Left border primer (638) ala3-4 (Salk_082157) Gene specific primers. Left border primer (1343) Supplemental Data. Poulsen et al. (2008) The Arabidopsis P4-ATPase pump ALA3 localizes to the Golgi and requires a β subunit to function in lipid translocation and secretory vesicle formation. A ala3-1

More information

Supporting Information

Supporting Information Supporting Information Üstün and Börnke, 2015 Figure S1: XopJ does not display acetyltransferase activity. Autoacetylation activity in vitro. Acetylation reactions using MBP, MBP-XopJ, GST and GST-HopZ1a

More information

SUPPLEMENTAL DATA. Supplementary data

SUPPLEMENTAL DATA. Supplementary data 1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 SUPPLEMENTAL DATA Supplementary data Figure S1: Verification of pla-iα1 knockdown lines a: Semiquantitative

More information

Supplemental Figure 1. Conserved regions of the kinase domain of PEPR1, PEPR2, CLV1 and BRI1.

Supplemental Figure 1. Conserved regions of the kinase domain of PEPR1, PEPR2, CLV1 and BRI1. Supplemental Figure 1. Conserved regions of the kinase domain of PEPR1, PEPR2, CLV1 and BRI1. The asterisks and colons indicate the important residues for ATP-binding pocket and substrate binding pocket,

More information

Supplemental Data. Dai et al. (2013). Plant Cell /tpc Absolute FyPP3. Absolute

Supplemental Data. Dai et al. (2013). Plant Cell /tpc Absolute FyPP3. Absolute A FyPP1 Absolute B FyPP3 Absolute Dry seeds Imbibed 24 hours Dry seeds Imbibed 24 hours C ABI5 Absolute Dry seeds Imbibed 24 hours Supplemental Figure 1. Expression of FyPP1, FyPP3 and ABI5 during seed

More information

Supplementary Methods

Supplementary Methods Supplementary Methods Reverse transcribed Quantitative PCR. Total RNA was isolated from bone marrow derived macrophages using RNeasy Mini Kit (Qiagen), DNase-treated (Promega RQ1), and reverse transcribed

More information

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Ca 2+ /calmodulin Regulates Salicylic Acid-mediated Plant Immunity Liqun Du, Gul S. Ali, Kayla A. Simons, Jingguo Hou, Tianbao Yang, A.S.N. Reddy and B. W. Poovaiah * *To whom correspondence should be

More information

Combining Techniques to Answer Molecular Questions

Combining Techniques to Answer Molecular Questions Combining Techniques to Answer Molecular Questions UNIT FM02 How to cite this article: Curr. Protoc. Essential Lab. Tech. 9:FM02.1-FM02.5. doi: 10.1002/9780470089941.etfm02s9 INTRODUCTION This manual is

More information

Supplemental Data. Guo et al. (2015). Plant Cell /tpc

Supplemental Data. Guo et al. (2015). Plant Cell /tpc Supplemental Figure 1. The Mutant exb1-d Displayed Pleiotropic Phenotypes and Produced Branches in the Axils of Cotyledons. (A) Branches were developed in exb1-d but not in wild-type plants. (B) and (C)

More information

A subclass of HSP70s regulate development and abiotic stress responses in Arabidopsis thaliana

A subclass of HSP70s regulate development and abiotic stress responses in Arabidopsis thaliana 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 Journal of Plant Research A subclass of HSP70s regulate development and abiotic stress responses in Arabidopsis thaliana Linna Leng 1 Qianqian Liang

More information

Supplementary Figure 1

Supplementary Figure 1 Supplementary Figure 1 Product purity of cytosine base editing for the wheat genomic loci tested. Product distributions and indels frequencies at four representative wheat genomic DNA sites in wheat protoplasts

More information

Site directed mutagenesis, Insertional and Deletion Mutagenesis. Mitesh Shrestha

Site directed mutagenesis, Insertional and Deletion Mutagenesis. Mitesh Shrestha Site directed mutagenesis, Insertional and Deletion Mutagenesis Mitesh Shrestha Mutagenesis Mutagenesis (the creation or formation of a mutation) can be used as a powerful genetic tool. By inducing mutations

More information

Fig. S1. TPL and TPL N176H protein interactions. (A) Semi-in vivo pull-down assays using recombinant GST N-TPL and GST N-TPL N176H fusions and

Fig. S1. TPL and TPL N176H protein interactions. (A) Semi-in vivo pull-down assays using recombinant GST N-TPL and GST N-TPL N176H fusions and Fig. S1. TPL and TPL N176H protein interactions. (A) Semi-in vivo pull-down assays using recombinant GST N-TPL and GST N-TPL N176H fusions and transgenic Arabidopsis TPL-HA lysates. Immunoblotting of input

More information

Supplementary Information. c d e

Supplementary Information. c d e Supplementary Information a b c d e f Supplementary Figure 1. atabcg30, atabcg31, and atabcg40 mutant seeds germinate faster than the wild type on ½ MS medium supplemented with ABA (a and d-f) Germination

More information

supplementary information

supplementary information DOI: 10.1038/ncb2172 Figure S1 p53 regulates cellular NADPH and lipid levels via inhibition of G6PD. (a) U2OS cells stably expressing p53 shrna or a control shrna were transfected with control sirna or

More information

9. What proteins will be affected by mutations in the trans-acting elements? Cis-acting elements?

9. What proteins will be affected by mutations in the trans-acting elements? Cis-acting elements? 6. What regulates the expression of a gene? 7. What are the cis- and trans-acting elements? 8. Can a deficiency in a trans-acting element be overcome by the addition of another copy of the gene to a cell?

More information

CNGC-encoded guard cell Ca 2+ -permeable channels

CNGC-encoded guard cell Ca 2+ -permeable channels Supplemental data CNGC-encoded guard cell Ca 2+ -permeable channels Julian I. Schroeder Division of Biological Sciences, Cell and Developmental Biology Section, University of California San Diego, 9500

More information

0.5% Sucrose. Supplemental Data. Chao et al. (2011). Plant Cell /tpc Col-0 tsc10a-2. Root length (mm)

0.5% Sucrose. Supplemental Data. Chao et al. (2011). Plant Cell /tpc Col-0 tsc10a-2. Root length (mm) A 0% 0.5% 1% Col-0 tsc10a-2 B Root length (mm) 35 30 25 20 15 10 5 0 0% 0.50% 1% 2% 4% Sucrose concentration 2% 4% Sucrose Col-0 tsc10a-2 Supplemental Figure 1. The effect of sucrose on root growth of

More information

The Arabidopsis Transcription Factor BES1 Is a Direct Substrate of MPK6 and Regulates Immunity

The Arabidopsis Transcription Factor BES1 Is a Direct Substrate of MPK6 and Regulates Immunity Supplemental Data The Arabidopsis Transcription Factor BES1 Is a Direct Substrate of MPK6 and Regulates Immunity Authors: Sining Kang, Fan Yang, Lin Li, Huamin Chen, She Chen and Jie Zhang The following

More information

Supplemental Data. Tang et al. Plant Cell. (2012) /tpc

Supplemental Data. Tang et al. Plant Cell. (2012) /tpc Supplemental Figure 1. Relative Pchlide Fluorescence of Various Mutants and Wild Type. Seedlings were grown in darkness for 5 d. Experiments were repeated 3 times with same results. Supplemental Figure

More information

SUPPORTING INFORMATION. A cleavage-responsive stem-loop hairpin for assaying guide RNA activity

SUPPORTING INFORMATION. A cleavage-responsive stem-loop hairpin for assaying guide RNA activity SUPPORTING INFORMATION A cleavage-responsive stem-loop hairpin for assaying guide RNA activity Tara R. deboer 1, Noreen Wauford 1, Jing-Yi Chung, Miguel Salvador Torres Perez, and Niren Murthy* University

More information