NGS sequence preprocessing. José Carbonell Caballero

Size: px
Start display at page:

Download "NGS sequence preprocessing. José Carbonell Caballero"

Transcription

1 NGS sequence preprocessing José Carbonell Caballero

2 Contents Data Format Quality Control Sequence capture Fasta and fastq formats Sequence quality encoding Evaluation of sequence quality Quality control tools Identification of typical artifacts Sequence filtering Practical session 2

3 Sequence capture RAW data Propietary format FastQ 3

4 Different technologies 4

5 Genome sequencing Reference genome 5

6 Where we are? Sequence preprocessing NGS pipeline Mapping Variant calling Downstream analysis 6

7 Fasta and Fastq formats Standard formats for sequence storage Text-based formats (easy to use!) (Almost) every programming language has a parser 7

8 Fasta format Nucleotide or peptide sequence >gi gb AAD cytochrome b [Elephas maximus maximus] LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX IENY >BBTBSCRYR tgcaccaaacatgtctaaagctggaaccaaaattactttctttgaagacaaaaactttca aggccgccactatgacagcgattgcgactgtgcagatttccacatgtacctgagccgctg caactccatcagagtggaaggaggcacctgggctgtgtatgaaaggcccaattttgctgg gtacatgtacatcctaccccggggcgagtatcctgagtaccagcactggatgggcctcaa Some typical file extensions (.fasta,.fa,.fna,.ffn,.faa,...) 8

9 Fasta format Allow multi-sequence (typically different chromosomes) >scaffold_1 CAAGGCTATAGCCCACCCGTTTTTGTGGCCTTTTTCCGCTGGACGAACTTGGCGCCCCGGCCTTCGGGTGGTTATTTTTG GGTGCAGCCTAGTGCGCGGCCTATTTTTGGCACACGGAGGCCCCTCGCAAAGTCTCGCGGCATTCCGAGTCCGGCGGACG AAGTTGGCCAGCCCCACCCCCCAAGGCTATAGCCCACCCGTTTTTGTGGCTTTTTTCCGCTGGACGAACTTGGCGCCCCG GCCTTCGGGCGGTTATTTTTGGCCGCGGCTTCGTCCGTGGCCTATTTTTGGCACACGGAGGCCCCCCGCAAACTCTCCCG GCATTCCGAGTCCGGCGGACGAAGTCGGCCAGCTTCACCACCCAGGCTGTTGCCCACCCCTTTTTGTGGCCTTTTTCCGC TGGACGAACTTGGCGCCCCAGCCTTTGGGCTGTTATTTATGGGTGCGGCTTTGTCTACGGCCTATTTTTGGCAGACGCAG GCCCCTCGCAAAGTCTCGCGGCATTCCGAGTCCGGCGGACGAAGTCGGCCAGCCCCACCCCCCAAGGCTATAGCCCACCC GTTTTTGTGGCCTTTTTCCGCTGGACGAACTTGGCGCCCCGGCCTTCGGGCGGTTTTTTTCTGGTGCGGTTTTGCCCGCG GCCTATTTTTGGCACTTGGAGGCCCCTCGTAAAGTCTCGCGGCATTCCGAGTCCGGCGGAAGAAGTTGGCCAGCCCCACC CTCCAAGGCTATAGCCCACCCGTTTTTGTGGCCTTTTTCCGCTGGACGAACTTGGGGCCCCGGCCTTCGGGCGGTTATTT -- >scaffold_2 ACGGTCCGGGGGCATCGGGGTGGGGGGGTAGCCGCGCGGCAGTTTGAACGGCGAAAAATGGGCAAGATCGGGGGCCGCTT AGTAGGCTTTGCCGGTTTCGGCCGTAACTCATGATCCGGGCCTCCGATTCCGTTTCCGTTTGGTCCCACGGGACCAGCGG TCCGGGGGCATCGGCAAGGGGGGGTAGCCGTGCGGCGGTTTGATCGCCGAAAAATGGGTAAGATCGGGGCCGTTTGGCCC GTTTTGCCGGTTTCGGCCCCCCGGGGGGCGGTTCATGCCCCGGGGGGGACAGCGGGGCGGGATCGGCACACGGCGGGTGA GGTGATCGGGTTCAGGCGGGTGCGGTCGGCGGCGGGGGCGCCCGGGGGGCTATAGCGCACCGCCTCGGGGGCCGCAAATT GGGGGCCGTAACTCATGATCGGGGCCCCCGATTCCGTTTCCGTTTCGTACCACGGGACCAGCGGTCCGGGGGCATCGGGA TGGGGGGGTAGCCGCGCGGCAGTTTGAACGGCGAAAAATGGGAAAGATCGGGGGCCGCTTAGTAGGCTTTGCCGGTTTCG GCCGTAACTCATGATCCGGGCCTCCGATTCCGTTTCCGTTTGGTCCCACGGGACCAGCGGTCCGGGGGCATCGGGATGGG GGGGTAGCCGTGCGGCGGTTTGATCGCCGAAAAATGGGTAAGATCGGGGCCGTTTGGCCCGTTTTGCCGGTTTCGGCCCC CCGGGGGGCGGTTCATGCCCCGGGGGGCGGTTCATGCCCCGGGGGGGACAGCGGGGCGGGATCGGTACACGGCGGGGGAG -- >scaffold_21 ACATATATAAAGTATTGTACTAGAAAACATTGTAAATGTATGCCTATTTAAACTTCAAGTATATGTAACACTTTCAAAGT CATAAGTGTAAAACTATTATATTTAAGATGTTTTGAGTTTATAAAAATAAACAACTTAACACTTCTACTCAGACGTTAAA AAATAAAAAACAAACATATTATTCTAATATATACATTCATACCCACTTAGACTCATTCAAGTTTAAGATATAAAAAAAAA AAAAGTGCTACCTAGAAATCCTTAATAGCAAGTCTTGTCTTTTATTTCATTAAGGGTAAAATCCTAAATGTGGCAAATGG CGTGTTATAAGAATTTTTGAGGGGTGCCAAATGCCCAATTCATTCATATTAGGCTTCTGAAAGAAGGCCCATTCATTCAC GACTTCGGGTCGCCCACCTGCTTGAATCCGTTTGTGTTTTTAACGTTGCAAGTATACCCATGTAAGTAAAAACAAACAAA 9

10 Fastq format Let's say fastq is a fasta with GATTTGGGGTTCAAAGCAGTATCGATCAAATAGTAAATCCATTTGTTCAACTCACAGTTT +!''*((((***+))%%%++)(%%%%).1***-+*''))**55CCF>>>>>>CCCCCCC65 Fasta storages genomes...and fastq fragments 10

11 Sequence quality encoding Base quality must be encoded in just 1 GATTTGGGGTTCAAAGCAGTATCGATCAAATAGTAAATCCATTTGTTCAACTCACAGTTT +!''*((((***+))%%%++)(%%%%).1***-+*''))**55CCF>>>>>>CCCCCCC65 Each base has a corresponding quality value (quality in position n, corresponds to base of position n) How is the encoding? Error probability Phred transformation (inversed integer value) ASCII encoding 11

12 Sequence quality encoding Phred + 33 Sanger [0,40] Illumina 1.8 [0,41] Phred + 64 Illumina 1.3 [0,40] Illumina 1.5 [3,40] 12

13 Sequence quality encoding Phred scores 13

14 Sequence quality encoding Phred scores Error probability Phred transformation (inversed integer value) ASCII GATTTGGGGTTCAAAGCAGTATCGATCAAATAGTAAATCCATTTGTTCAACTCACAGTTT +!''*((((***+))%%%++)(%%%%).1***-+*''))**55CCF>>>>>>CCCCCCC65 P = 0.01 Q = -10*log10(0.01) = 20 Phred+33 ASCII = 53 => 5 P = 1 Q = -10*log10(0.01) = 0 Phred+33 ASCII 33+0 = 33 =>! 14

15 Evaluation of sequence quality Primary tool to assess sequencing If we evaluate our sequence quality in deep then we will known how reliable are our results QC determines posterior filtering We must be consistent with any filtering decision......if not, dowstream analysis will suffer the consequences QC must be test after every critical step 15

16 Evaluation of sequence quality How? quality per base Quality (or error probability) will be also a topic in next pipeline steps 16

17 Quality control tools FastQC 17

18 Quality control tools fastx-toolkit 18

19 Quality control tools NGS QC Toolkit 19

20 Quality control tools Example GOOD quality sequence_short_fastqc/fastqc_report.html POOR quality _sequence_fastqc/fastqc_report.html 20

21 Typical artifacts Sequence adapters 21

22 Typical artifacts Poor quality data 22

23 Typical artifacts Platform dependent 23

24 Sequence filtering (and editing) remove bad quality data Improve confidence of downstream analysis 24

25 Sequence filtering (and editing) Tail quality trimming minimum quality threshold 25

26 Sequence filtering (and editing) Mean quality Read length Read length after trimming Percentage of bases above Q Adapter trimming Adapter reads 26

27 Sequence filtering tools Fastx-toolkit Galaxy ( SeqTK ( Cutadapt ( And more... 27

28 Any question? 28

Francisco García Quality Control for NGS Raw Data

Francisco García Quality Control for NGS Raw Data Contents Data formats Sequence capture Fasta and fastq formats Sequence quality encoding Quality Control Evaluation of sequence quality Quality control tools Identification of artifacts & filtering Practical

More information

Basic Bioinformatics: Homology, Sequence Alignment,

Basic Bioinformatics: Homology, Sequence Alignment, Basic Bioinformatics: Homology, Sequence Alignment, and BLAST William S. Sanders Institute for Genomics, Biocomputing, and Biotechnology (IGBB) High Performance Computing Collaboratory (HPC 2 ) Mississippi

More information

DATA FORMATS AND QUALITY CONTROL

DATA FORMATS AND QUALITY CONTROL HTS Summer School 12-16th September 2016 DATA FORMATS AND QUALITY CONTROL Romina Petersen, University of Cambridge (rp520@medschl.cam.ac.uk) Luigi Grassi, University of Cambridge (lg490@medschl.cam.ac.uk)

More information

BST 226 Statistical Methods for Bioinformatics David M. Rocke. March 10, 2014 BST 226 Statistical Methods for Bioinformatics 1

BST 226 Statistical Methods for Bioinformatics David M. Rocke. March 10, 2014 BST 226 Statistical Methods for Bioinformatics 1 BST 226 Statistical Methods for Bioinformatics David M. Rocke March 10, 2014 BST 226 Statistical Methods for Bioinformatics 1 NGS Technologies Illumina Sequencing HiSeq 2500 & MiSeq PacBio Sequencing PacBio

More information

Quality assessment and control of sequence data. Naiara Rodríguez-Ezpeleta

Quality assessment and control of sequence data. Naiara Rodríguez-Ezpeleta Quality assessment and control of sequence data Naiara Rodríguez-Ezpeleta Workshop on Genomics 2014 Quality control is important Some of the artefacts/problems that can be detected with QC Sequencing Sequence

More information

Data Basics. Josef K Vogt Slides by: Simon Rasmussen Next Generation Sequencing Analysis

Data Basics. Josef K Vogt Slides by: Simon Rasmussen Next Generation Sequencing Analysis Data Basics Josef K Vogt Slides by: Simon Rasmussen 2017 Generalized NGS analysis Sample prep & Sequencing Data size Main data reductive steps SNPs, genes, regions Application Assembly: Compare Raw Pre-

More information

Quality assessment and control of sequence data

Quality assessment and control of sequence data Quality assessment and control of sequence data Naiara Rodríguez-Ezpeleta Workshop on Genomics 2015 Cesky Krumlov fastq format fasta Most basic file format to represent nucleotide or amino-acid sequences

More information

Illumina Sequencing Error Profiles and Quality Control

Illumina Sequencing Error Profiles and Quality Control Illumina Sequencing Error Profiles and Quality Control RNA-seq Workflow Biological samples/library preparation Sequence reads FASTQC Adapter Trimming (Optional) Splice-aware mapping to genome Counting

More information

Two Mark question and Answers

Two Mark question and Answers 1. Define Bioinformatics Two Mark question and Answers Bioinformatics is the field of science in which biology, computer science, and information technology merge into a single discipline. There are three

More information

Lecture 7. Next-generation sequencing technologies

Lecture 7. Next-generation sequencing technologies Lecture 7 Next-generation sequencing technologies Next-generation sequencing technologies General principles of short-read NGS Construct a library of fragments Generate clonal template populations Massively

More information

Sanger vs Next-Gen Sequencing

Sanger vs Next-Gen Sequencing Tools and Algorithms in Bioinformatics GCBA815/MCGB815/BMI815, Fall 2017 Week-8: Next-Gen Sequencing RNA-seq Data Analysis Babu Guda, Ph.D. Professor, Genetics, Cell Biology & Anatomy Director, Bioinformatics

More information

Bioinformatics for NGS projects. Guidelines. genomescan.nl

Bioinformatics for NGS projects. Guidelines. genomescan.nl Next Generation Sequencing Bioinformatics for NGS projects Guidelines genomescan.nl GenomeScan s Guidelines for Bioinformatics Services on NGS Data Using our own proprietary data analysis pipelines Dear

More information

Ecole de Bioinforma(que AVIESAN Roscoff 2014 GALAXY INITIATION. A. Lermine U900 Ins(tut Curie, INSERM, Mines ParisTech

Ecole de Bioinforma(que AVIESAN Roscoff 2014 GALAXY INITIATION. A. Lermine U900 Ins(tut Curie, INSERM, Mines ParisTech GALAXY INITIATION A. Lermine U900 Ins(tut Curie, INSERM, Mines ParisTech How does Next- Gen sequencing work? DNA fragmentation Size selection and clonal amplification Massive parallel sequencing ACCGTTTGCCG

More information

Genomic DNA ASSEMBLY BY REMAPPING. Course overview

Genomic DNA ASSEMBLY BY REMAPPING. Course overview ASSEMBLY BY REMAPPING Laurent Falquet, The Bioinformatics Unravelling Group, UNIFR & SIB MA/MER @ UniFr Group Leader @ SIB Course overview Genomic DNA PacBio Illumina methylation de novo remapping Annotation

More information

RADseq Data Analysis Workshop 3 February 2017

RADseq Data Analysis Workshop 3 February 2017 RADseq Data Analysis Workshop 3 February 2017 Introduction to Galaxy (thanks to Simon Gladman for slides) What is Galaxy? A web-based scalable workflow platform for genomic analysis Designed for biologists

More information

Why QC? Next-Generation Sequencing: Quality Control. Illumina data format. Fastq format:

Why QC? Next-Generation Sequencing: Quality Control. Illumina data format. Fastq format: Why QC? Next-Generation Sequencing: Quality Control BaRC Hot Topics January 2017 Bioinformatics and Research Computing Whitehead Institute Do you want to include the reads with low quality base calls?

More information

Next-Generation Sequencing: Quality Control

Next-Generation Sequencing: Quality Control Next-Generation Sequencing: Quality Control Bingbing Yuan BaRC Hot Topics January 2017 Bioinformatics and Research Computing Whitehead Institute http://barc.wi.mit.edu/hot_topics/ Why QC? Do you want to

More information

NEXT GENERATION SEQUENCING. Farhat Habib

NEXT GENERATION SEQUENCING. Farhat Habib NEXT GENERATION SEQUENCING HISTORY HISTORY Sanger Dominant for last ~30 years 1000bp longest read Based on primers so not good for repetitive or SNPs sites HISTORY Sanger Dominant for last ~30 years 1000bp

More information

C3BI. VARIANTS CALLING November Pierre Lechat Stéphane Descorps-Declère

C3BI. VARIANTS CALLING November Pierre Lechat Stéphane Descorps-Declère C3BI VARIANTS CALLING November 2016 Pierre Lechat Stéphane Descorps-Declère General Workflow (GATK) software websites software bwa picard samtools GATK IGV tablet vcftools website http://bio-bwa.sourceforge.net/

More information

Lecture 2: Biology Basics Con4nued

Lecture 2: Biology Basics Con4nued Lecture 2: Biology Basics Con4nued Central Dogma DNA: The Code of Life The structure and the four genomic le=ers code for all living organisms Adenine, Guanine, Thymine, and Cytosine which pair A- T and

More information

Quality Control of Sequencing Data

Quality Control of Sequencing Data Quality Control of Sequencing Data Surya Saha Sol Genomics Network (SGN) Boyce Thompson Institute, Ithaca, NY ss2489@cornell.edu // Twitter:@SahaSurya BTI Plant Bioinformatics Course 2015 Slides: Aureliano

More information

Sequencing techniques

Sequencing techniques Sequencing techniques Workshop on Whole Genome Sequencing and Analysis, 2-4 Oct. 2017 Learning objective: After this lecture, you should be able to account for different techniques for whole genome sequencing

More information

DNA concentration and purity were initially measured by NanoDrop 2000 and verified on Qubit 2.0 Fluorometer.

DNA concentration and purity were initially measured by NanoDrop 2000 and verified on Qubit 2.0 Fluorometer. DNA Preparation and QC Extraction DNA was extracted from whole blood or flash frozen post-mortem tissue using a DNA mini kit (QIAmp #51104 and QIAmp#51404, respectively) following the manufacturer s recommendations.

More information

Experimental Design. Sequencing. Data Quality Control. Read mapping. Differential Expression analysis

Experimental Design. Sequencing. Data Quality Control. Read mapping. Differential Expression analysis -Seq Analysis Quality Control checks Reproducibility Reliability -seq vs Microarray Higher sensitivity and dynamic range Lower technical variation Available for all species Novel transcript identification

More information

RNA-Seq Module 2 From QC to differential gene expression.

RNA-Seq Module 2 From QC to differential gene expression. RNA-Seq Module 2 From QC to differential gene expression. Ying Zhang Ph.D, Informatics Analyst Research Informatics Support System (RISS) MSI Apr. 24, 2012 RNA-Seq Tutorials Tutorial 1: Introductory (Mar.

More information

Next-generation sequencing and quality control: An introduction 2016

Next-generation sequencing and quality control: An introduction 2016 Next-generation sequencing and quality control: An introduction 2016 s.schmeier@massey.ac.nz http://sschmeier.com/bioinf-workshop/ Overview Typical workflow of a genomics experiment Genome versus transcriptome

More information

Next Gen Sequencing. Expansion of sequencing technology. Contents

Next Gen Sequencing. Expansion of sequencing technology. Contents Next Gen Sequencing Contents 1 Expansion of sequencing technology 2 The Next Generation of Sequencing: High-Throughput Technologies 3 High Throughput Sequencing Applied to Genome Sequencing (TEDed CC BY-NC-ND

More information

De Novo Assembly of High-throughput Short Read Sequences

De Novo Assembly of High-throughput Short Read Sequences De Novo Assembly of High-throughput Short Read Sequences Chuming Chen Center for Bioinformatics and Computational Biology (CBCB) University of Delaware NECC Third Skate Genome Annotation Workshop May 23,

More information

ISO/IEC JTC 1/SC 29/WG 11 N15527 Warsaw, CH June Introduction

ISO/IEC JTC 1/SC 29/WG 11 N15527 Warsaw, CH June Introduction INTERNATIONAL ORGANISATION FOR STANDARDISATION ORGANISATION INTERNATIONALE DE NORMALISATION ISO/IEC JTC 1/SC 29/WG 11 CODING OF MOVING PICTURES AND AUDIO ISO/IEC JTC 1/SC 29/WG 11 N15527 Warsaw, CH June

More information

Introductie en Toepassingen van Next-Generation Sequencing in de Klinische Virologie. Sander van Boheemen Medical Microbiology

Introductie en Toepassingen van Next-Generation Sequencing in de Klinische Virologie. Sander van Boheemen Medical Microbiology Introductie en Toepassingen van Next-Generation Sequencing in de Klinische Virologie Sander van Boheemen Medical Microbiology Next-generation sequencing Next-generation sequencing (NGS), also known as

More information

Introduction to NGS. Data Analysis

Introduction to NGS. Data Analysis Introduction to NGS (Now Generation Sequencing) Data Analysis Alex Sánchez Statistics and Bioinformatics Research Group Statistics department, Universitat de Barelona Statistics and Bioinformatics Unit

More information

Mapping Next Generation Sequence Reads. Bingbing Yuan Dec. 2, 2010

Mapping Next Generation Sequence Reads. Bingbing Yuan Dec. 2, 2010 Mapping Next Generation Sequence Reads Bingbing Yuan Dec. 2, 2010 1 What happen if reads are not mapped properly? Some data won t be used, thus fewer reads would be aligned. Reads are mapped to the wrong

More information

DNASeq: Analysis pipeline and file formats Sumir Panji, Gerrit Boha and Amel Ghouila

DNASeq: Analysis pipeline and file formats Sumir Panji, Gerrit Boha and Amel Ghouila DNASeq: Analysis pipeline and file formats Sumir Panji, Gerrit Boha and Amel Ghouila Bioinforma>cs analysis and annota>on of variants in NGS data workshop Cape Town, 4th to 6th April 2016 DNA Sequencing:

More information

NGS in Pathology Webinar

NGS in Pathology Webinar NGS in Pathology Webinar NGS Data Analysis March 10 2016 1 Topics for today s presentation 2 Introduction Next Generation Sequencing (NGS) is becoming a common and versatile tool for biological and medical

More information

De Novo Assembly (Pseudomonas aeruginosa MAPO1 ) Sample to Insight

De Novo Assembly (Pseudomonas aeruginosa MAPO1 ) Sample to Insight De Novo Assembly (Pseudomonas aeruginosa MAPO1 ) Sample to Insight 1 Workflow Import NGS raw data QC on reads De novo assembly Trim reads Finding Genes BLAST Sample to Insight Case Study Pseudomonas aeruginosa

More information

NUCLEIC ACIDS. DNA (Deoxyribonucleic Acid) and RNA (Ribonucleic Acid): information storage molecules made up of nucleotides.

NUCLEIC ACIDS. DNA (Deoxyribonucleic Acid) and RNA (Ribonucleic Acid): information storage molecules made up of nucleotides. NUCLEIC ACIDS DNA (Deoxyribonucleic Acid) and RNA (Ribonucleic Acid): information storage molecules made up of nucleotides. Base Adenine Guanine Cytosine Uracil Thymine Abbreviation A G C U T DNA RNA 2

More information

Read Quality Assessment & Improvement. UCD Genome Center Bioinformatics Core Tuesday 14 June 2016

Read Quality Assessment & Improvement. UCD Genome Center Bioinformatics Core Tuesday 14 June 2016 Read Quality Assessment & Improvement UCD Genome Center Bioinformatics Core Tuesday 14 June 2016 QA&I should be interactive Error modes Each technology has unique error modes, depending on the physico-chemical

More information

Analytics Behind Genomic Testing

Analytics Behind Genomic Testing A Quick Guide to the Analytics Behind Genomic Testing Elaine Gee, PhD Director, Bioinformatics ARUP Laboratories 1 Learning Objectives Catalogue various types of bioinformatics analyses that support clinical

More information

Lecture 3: Biology Basics Con4nued. Spring 2017 January 24, 2017

Lecture 3: Biology Basics Con4nued. Spring 2017 January 24, 2017 Lecture 3: Biology Basics Con4nued Spring 2017 January 24, 2017 Genotype/Phenotype Blue eyes Phenotype: Brown eyes Recessive: bb Genotype: Dominant: Bb or BB Genes are shown in rela%ve order and distance

More information

Quality control for Sequencing Experiments

Quality control for Sequencing Experiments Quality control for Sequencing Experiments v2018-04 Simon Andrews simon.andrews@babraham.ac.uk Support service for bioinformatics Academic Babraham Institute Commercial Consultancy Support BI Sequencing

More information

Genome 373: Mapping Short Sequence Reads II. Doug Fowler

Genome 373: Mapping Short Sequence Reads II. Doug Fowler Genome 373: Mapping Short Sequence Reads II Doug Fowler The final Will be in this room on June 6 th at 8:30a Will be focused on the second half of the course, but will include material from the first half

More information

Genomics AGRY Michael Gribskov Hock 331

Genomics AGRY Michael Gribskov Hock 331 Genomics AGRY 60000 Michael Gribskov gribskov@purdue.edu Hock 331 Computing Essentials Resources In this course we will assemble and annotate both genomic and transcriptomic sequence assemblies We will

More information

Galaxy for Next Generation Sequencing 初探次世代序列分析平台 蘇聖堯 2013/9/12

Galaxy for Next Generation Sequencing 初探次世代序列分析平台 蘇聖堯 2013/9/12 Galaxy for Next Generation Sequencing 初探次世代序列分析平台 蘇聖堯 2013/9/12 What s Galaxy? Bringing Developers And Biologists Together. Reproducible Science Is Our Goal An open, web-based platform for data intensive

More information

Course Presentation. Ignacio Medina Presentation

Course Presentation. Ignacio Medina Presentation Course Index Introduction Agenda Analysis pipeline Some considerations Introduction Who we are Teachers: Marta Bleda: Computational Biologist and Data Analyst at Department of Medicine, Addenbrooke's Hospital

More information

Introduction of RNA-Seq Analysis

Introduction of RNA-Seq Analysis Introduction of RNA-Seq Analysis Jiang Li, MS Bioinformatics System Engineer I Center for Quantitative Sciences(CQS) Vanderbilt University September 21, 2012 Goal of this talk 1. Act as a practical resource

More information

Quality assurance in NGS (diagnostics)

Quality assurance in NGS (diagnostics) Quality assurance in NGS (diagnostics) Chris Mattocks National Genetics Reference Laboratory (Wessex) Research Diagnostics Quality assurance Any systematic process of checking to see whether a product

More information

Bioinformatics small variants Data Analysis. Guidelines. genomescan.nl

Bioinformatics small variants Data Analysis. Guidelines. genomescan.nl Next Generation Sequencing Bioinformatics small variants Data Analysis Guidelines genomescan.nl GenomeScan s Guidelines for Small Variant Analysis on NGS Data Using our own proprietary data analysis pipelines

More information

Differential gene expression analysis using RNA-seq

Differential gene expression analysis using RNA-seq https://abc.med.cornell.edu/ Differential gene expression analysis using RNA-seq Applied Bioinformatics Core, March 2018 Friederike Dündar with Luce Skrabanek & Paul Zumbo Day 1: Introduction into high-throughput

More information

A step-by-step guide to ChIP-seq data analysis

A step-by-step guide to ChIP-seq data analysis A step-by-step guide to ChIP-seq data analysis December 03, 2014 Xi Chen, Ph.D. EMBL-European Bioinformatics Institute Wellcome Trust Sanger Institute Target audience Wet-lab biologists with no experience

More information

Next Generation Sequencing Lecture Saarbrücken, 19. March Sequencing Platforms

Next Generation Sequencing Lecture Saarbrücken, 19. March Sequencing Platforms Next Generation Sequencing Lecture Saarbrücken, 19. March 2012 Sequencing Platforms Contents Introduction Sequencing Workflow Platforms Roche 454 ABI SOLiD Illumina Genome Anlayzer / HiSeq Problems Quality

More information

Transcriptomics analysis with RNA seq: an overview Frederik Coppens

Transcriptomics analysis with RNA seq: an overview Frederik Coppens Transcriptomics analysis with RNA seq: an overview Frederik Coppens Platforms Applications Analysis Quantification RNA content Platforms Platforms Short (few hundred bases) Long reads (multiple kilobases)

More information

European Union Reference Laboratory for Genetically Modified Food and Feed (EURL GMFF)

European Union Reference Laboratory for Genetically Modified Food and Feed (EURL GMFF) Guideline for the submission of DNA sequences derived from genetically modified organisms and associated annotations within the framework of Directive 2001/18/EC and Regulation (EC) No 1829/2003 European

More information

Deep Sequencing technologies

Deep Sequencing technologies Deep Sequencing technologies Gabriela Salinas 30 October 2017 Transcriptome and Genome Analysis Laboratory http://www.uni-bc.gwdg.de/index.php?id=709 Microarray and Deep-Sequencing Core Facility University

More information

UAB DNA-Seq Analysis Workshop. John Osborne Research Associate Centers for Clinical and Translational Science

UAB DNA-Seq Analysis Workshop. John Osborne Research Associate Centers for Clinical and Translational Science + UAB DNA-Seq Analysis Workshop John Osborne Research Associate Centers for Clinical and Translational Science ozborn@uab.,edu + Thanks in advance You are the Guinea pigs for this workshop! At this point

More information

Comparing a few SNP calling algorithms using low-coverage sequencing data

Comparing a few SNP calling algorithms using low-coverage sequencing data Yu and Sun BMC Bioinformatics 2013, 14:274 RESEARCH ARTICLE Open Access Comparing a few SNP calling algorithms using low-coverage sequencing data Xiaoqing Yu 1 and Shuying Sun 1,2* Abstract Background:

More information

RNA-Seq de novo assembly training

RNA-Seq de novo assembly training RNA-Seq de novo assembly training Training session aims Give you some keys elements to look at during read quality check. Transcriptome assembly is not completely a strait forward process : Multiple strategies

More information

QIAseq Targeted Panel Analysis Plugin USER MANUAL

QIAseq Targeted Panel Analysis Plugin USER MANUAL QIAseq Targeted Panel Analysis Plugin USER MANUAL User manual for QIAseq Targeted Panel Analysis 1.1 Windows, macos and Linux June 18, 2018 This software is for research purposes only. QIAGEN Aarhus Silkeborgvej

More information

NGS, Cancer and Bioinformatics. 5/3/2015 Yannick Boursin

NGS, Cancer and Bioinformatics. 5/3/2015 Yannick Boursin NGS, Cancer and Bioinformatics 5/3/2015 Yannick Boursin 1 NGS and Clinical Oncology NGS in hereditary cancer genome testing BRCA1/2 (breast/ovary cancer) XPC (melanoma) ERCC1 (colorectal cancer) NGS for

More information

Introduction to CGE tools

Introduction to CGE tools Introduction to CGE tools Pimlapas Leekitcharoenphon (Shinny) Research Group of Genomic Epidemiology, DTU-Food. WHO Collaborating Centre for Antimicrobial Resistance in Foodborne Pathogens and Genomics.

More information

Session 8. Differential gene expression analysis using RNAseq data

Session 8. Differential gene expression analysis using RNAseq data Functional and Comparative Genomics 2018 Session 8. Differential gene expression analysis using RNAseq data Tutors: Hrant Hovhannisyan, PhD student, email: grant.hovhannisyan@gmail.com Uciel Chorostecki,

More information

Analysis of RNA-seq Data. Feb 8, 2017 Peikai CHEN (PHD)

Analysis of RNA-seq Data. Feb 8, 2017 Peikai CHEN (PHD) Analysis of RNA-seq Data Feb 8, 2017 Peikai CHEN (PHD) Outline What is RNA-seq? What can RNA-seq do? How is RNA-seq measured? How to process RNA-seq data: the basics How to visualize and diagnose your

More information

Sequencing technologies. Jose Blanca COMAV institute bioinf.comav.upv.es

Sequencing technologies. Jose Blanca COMAV institute bioinf.comav.upv.es Sequencing technologies Jose Blanca COMAV institute bioinf.comav.upv.es Outline Sequencing technologies: Sanger 2nd generation sequencing: 3er generation sequencing: 454 Illumina SOLiD Ion Torrent PacBio

More information

GENOME ASSEMBLY FINAL PIPELINE AND RESULTS

GENOME ASSEMBLY FINAL PIPELINE AND RESULTS GENOME ASSEMBLY FINAL PIPELINE AND RESULTS Faction 1 Yanxi Chen Carl Dyson Sean Lucking Chris Monaco Shashwat Deepali Nagar Jessica Rowell Ankit Srivastava Camila Medrano Trochez Venna Wang Seyed Alireza

More information

Applications of short-read

Applications of short-read Applications of short-read sequencing: RNA-Seq and ChIP-Seq BaRC Hot Topics March 2013 George Bell, Ph.D. http://jura.wi.mit.edu/bio/education/hot_topics/ Sequencing applications RNA-Seq includes experiments

More information

An overhang-based DNA block shuffling method for creating a customized random library

An overhang-based DNA block shuffling method for creating a customized random library An overhang-based DNA block shuffling method for creating a customized random library Kosuke Fujishima, Chris Venter, Kendrick Wang, Raphael Ferreira and Lynn J. Rothschild Supplementary figures and text:

More information

BIGpre: A Quality Assessment Package for Next-Generation Sequencing Data

BIGpre: A Quality Assessment Package for Next-Generation Sequencing Data GENOMICS PROTEOMICS & BIOINFORMATICS www.sciencedirect.com/science/journal/16720229 Application Note BIGpre: A Quality Assessment Package for Next-Generation Sequencing Data Tongwu Zhang 1,2, Yingfeng

More information

MEEPTOOLS: A maximum expected error based FASTQ read filtering and trimming toolkit

MEEPTOOLS: A maximum expected error based FASTQ read filtering and trimming toolkit MEEPTOOLS: A maximum expected error based FASTQ read filtering and trimming toolkit Vishal N. Koparde 1* (vnkoparde@vcu.edu) Hardik I. Parikh 2 (parikhhi@vcu.edu) Steven P. Bradley 2 (bradleysp@vcu.edu)

More information

From raw reads to variants

From raw reads to variants From raw reads to variants Sebastian DiLorenzo Sebastian.DiLorenzo@NBIS.se Talk Overview Concepts Reference genome Variants Paired-end data NGS Workflow Quality control & Trimming Alignment Local realignment

More information

Supplementary Figures and Data

Supplementary Figures and Data Supplementary Figures and Data Whole Exome Screening Identifies Novel and Recurrent WISP3 Mutations Causing Progressive Pseudorheumatoid Dysplasia in Jammu and Kashmir India Ekta Rai 1, Ankit Mahajan 2,

More information

Parts of a standard FastQC report

Parts of a standard FastQC report FastQC FastQC, written by Simon Andrews of Babraham Bioinformatics, is a very popular tool used to provide an overview of basic quality control metrics for raw next generation sequencing data. There are

More information

Next Generation Sequencing: An Overview

Next Generation Sequencing: An Overview Next Generation Sequencing: An Overview Cavan Reilly November 13, 2017 Table of contents Next generation sequencing NGS and microarrays Study design Quality assessment Burrows Wheeler transform Next generation

More information

Assignment 9: Genetic Variation

Assignment 9: Genetic Variation Assignment 9: Genetic Variation Due Date: Friday, March 30 th, 2018, 10 am In this assignment, you will profile genome variation information and attempt to answer biologically relevant questions. The variant

More information

Sequencing applications. Today's outline. Hands-on exercises. Applications of short-read sequencing: RNA-Seq and ChIP-Seq

Sequencing applications. Today's outline. Hands-on exercises. Applications of short-read sequencing: RNA-Seq and ChIP-Seq Sequencing applications Applications of short-read sequencing: RNA-Seq and ChIP-Seq BaRC Hot Topics March 2013 George Bell, Ph.D. http://jura.wi.mit.edu/bio/education/hot_topics/ RNA-Seq includes experiments

More information

DNBseq TM SERVICE OVERVIEW Plant and Animal Whole Genome Re-Sequencing

DNBseq TM SERVICE OVERVIEW Plant and Animal Whole Genome Re-Sequencing TM SERVICE OVERVIEW Plant and Animal Whole Genome Re-Sequencing Plant and animal whole genome re-sequencing (WGRS) involves sequencing the entire genome of a plant or animal and comparing the sequence

More information

Chang Xu Mohammad R Nezami Ranjbar Zhong Wu John DiCarlo Yexun Wang

Chang Xu Mohammad R Nezami Ranjbar Zhong Wu John DiCarlo Yexun Wang Supplementary Materials for: Detecting very low allele fraction variants using targeted DNA sequencing and a novel molecular barcode-aware variant caller Chang Xu Mohammad R Nezami Ranjbar Zhong Wu John

More information

Introduction to Bioinformatics analysis of Metabarcoding data

Introduction to Bioinformatics analysis of Metabarcoding data Introduction to Bioinformatics analysis of Metabarcoding data Theoretical part Alvaro Sebastián Yagüe Experimental design Sampling Sample processing Sequencing Sequence processing Experimental design Sampling

More information

Differential gene expression analysis using RNA-seq

Differential gene expression analysis using RNA-seq https://abc.med.cornell.edu/ Differential gene expression analysis using RNA-seq Applied Bioinformatics Core, August 2017 Friederike Dündar with Luce Skrabanek & Ceyda Durmaz Day 1: Introduction into high-throughput

More information

RNA-Seq Analysis. Simon Andrews, Laura v

RNA-Seq Analysis. Simon Andrews, Laura v RNA-Seq Analysis Simon Andrews, Laura Biggins simon.andrews@babraham.ac.uk @simon_andrews v2018-10 RNA-Seq Libraries rrna depleted mrna Fragment u u u u NNNN Random prime + RT 2 nd strand synthesis (+

More information

RNA-seq data analysis with Chipster. Eija Korpelainen CSC IT Center for Science, Finland

RNA-seq data analysis with Chipster. Eija Korpelainen CSC IT Center for Science, Finland RNA-seq data analysis with Chipster Eija Korpelainen CSC IT Center for Science, Finland chipster@csc.fi What will I learn? 1. What you can do with Chipster and how to operate it 2. What RNA-seq can be

More information

Astrocyte GCRB/BICF Workflow for ChIP-Seq Analysis. Venkat Beibei

Astrocyte GCRB/BICF Workflow for ChIP-Seq Analysis. Venkat Beibei Astrocyte GCRB/BICF Workflow for ChIP-Seq Analysis Venkat Malladi @GCRB Beibei Chen @BICF What%is%ChIP+Seq?% Chromatin immunoprecipitation followed by Sequencing (ChIP-Seq): Identify the binding sites

More information

Normal-Tumor Comparison using Next-Generation Sequencing Data

Normal-Tumor Comparison using Next-Generation Sequencing Data Normal-Tumor Comparison using Next-Generation Sequencing Data Chun Li Vanderbilt University Taichung, March 16, 2011 Next-Generation Sequencing First-generation (Sanger sequencing): 115 kb per day per

More information

RNA Seq: Methods and Applica6ons. Prat Thiru

RNA Seq: Methods and Applica6ons. Prat Thiru RNA Seq: Methods and Applica6ons Prat Thiru 1 Outline Intro to RNA Seq Biological Ques6ons Comparison with Other Methods RNA Seq Protocol RNA Seq Applica6ons Annota6on Quan6fica6on Other Applica6ons Expression

More information

Introduction to RNA sequencing

Introduction to RNA sequencing Introduction to RNA sequencing Bioinformatics perspective Olga Dethlefsen NBIS, National Bioinformatics Infrastructure Sweden November 2017 Olga (NBIS) RNA-seq November 2017 1 / 49 Outline Why sequence

More information

Fast, Accurate and Sensitive DNA Variant Detection from Sanger Sequencing:

Fast, Accurate and Sensitive DNA Variant Detection from Sanger Sequencing: Fast, Accurate and Sensitive DNA Variant Detection from Sanger Sequencing: Patented, Anti-Correlation Technology Provides 99.5% Accuracy & Sensitivity to 5% Variant Knowledge Base and External Annotation

More information

Herramientas para el diseño y el análisis de datos de paneles de genes

Herramientas para el diseño y el análisis de datos de paneles de genes Herramientas para el diseño y el análisis de datos de paneles de genes Hospital Sant Pau Barcelona, 16 Jun 2016 BIER Francisco García fgarcia@cipf.es Departamento de Genómica Computacional. CIPF Príncipe

More information

Experimental Design Microbial Sequencing

Experimental Design Microbial Sequencing Experimental Design Microbial Sequencing Matthew L. Settles Genome Center Bioinformatics Core University of California, Davis settles@ucdavis.edu; bioinformatics.core@ucdavis.edu General rules for preparing

More information

Faction 2: Genome Assembly Lab and Preliminary Data

Faction 2: Genome Assembly Lab and Preliminary Data Faction 2: Genome Assembly Lab and Preliminary Data [Computational Genomics 2017] Christian Colon, Erisa Sula, David Lu, Tian Jin, Lijiang Long, Rohini Mopuri, Bowen Yang, Saminda Wijeratne, Harrison Kim

More information

Read Mapping and Variant Calling. Johannes Starlinger

Read Mapping and Variant Calling. Johannes Starlinger Read Mapping and Variant Calling Johannes Starlinger Application Scenario: Personalized Cancer Therapy Different mutations require different therapy Collins, Meredith A., and Marina Pasca di Magliano.

More information

Bionano Solve v3.0.1 Release Notes

Bionano Solve v3.0.1 Release Notes Bionano Solve v3.0.1 Release Notes Document Number: 30157 Document Revision: B For Research Use Only. Not for use in diagnostic procedures. Copyright 2017 Bionano Genomics, Inc. All Rights Reserved. Table

More information

VALIDATION OF HLA TYPING BY NGS

VALIDATION OF HLA TYPING BY NGS VALIDATION OF HLA TYPING BY NGS Eric T. Weimer, Ph.D., D(ABMLI) Assistant Professor, Pathology and Laboratory Medicine Associate Director, Clinical Flow Cytometry, HLA, and Immunology Laboratories CONFLICT

More information

2nd (Next) Generation Sequencing 2/2/2018

2nd (Next) Generation Sequencing 2/2/2018 2nd (Next) Generation Sequencing 2/2/2018 Why do we want to sequence a genome? - To see the sequence (assembly) To validate an experiment (insert or knockout) To compare to another genome and find variations

More information

CBC Data Therapy. Metagenomics Discussion

CBC Data Therapy. Metagenomics Discussion CBC Data Therapy Metagenomics Discussion General Workflow Microbial sample Generate Metaomic data Process data (QC, etc.) Analysis Marker Genes Extract DNA Amplify with targeted primers Filter errors,

More information

Zika infected human samples

Zika infected human samples Lecture 16 RNA-seq Zika infected human samples Experimental design ZIKV-infected hnpcs 56 hours after ZIKA and mock infection in parallel cultures were used for global transcriptome analysis. RNA-seq libraries

More information

SMRT Analysis Barcoding Overview

SMRT Analysis Barcoding Overview SMRT Analysis Barcoding Overview Introduction This document is for users with Sequel Systems using SMRT Link v5.0.0 or v5.0.1. This document covers: Barcoding designs, strategies and modes for preparing

More information

Introduction to bioinformatics (NGS data analysis)

Introduction to bioinformatics (NGS data analysis) Introduction to bioinformatics (NGS data analysis) Alexander Jueterbock 2015-06-02 1 / 45 Got your sequencing data - now, what to do with it? File size: several Gb Number of lines: >1,000,000 @M02443:17:000000000-ABPBW:1:1101:12675:1533

More information

Introduction to DNA-Sequencing

Introduction to DNA-Sequencing informatics.sydney.edu.au sih.info@sydney.edu.au The Sydney Informatics Hub provides support, training, and advice on research data, analyses and computing. Talk to us about your computing infrastructure,

More information

N ext-generation sequencing (NGS) technologies have become common practice in life science1. Benefited

N ext-generation sequencing (NGS) technologies have become common practice in life science1. Benefited OPEN SUBJECT AREAS: DATA PROCESSING HIGH-THROUGHPUT SCREENING BIOINFORMATICS Received 31 July 2014 Accepted 20 October 2014 Published 7 November 2014 Correspondence and requests for materials should be

More information

CS 680: Assembly and Analysis of Sequencing Data. Fall 2012 August 21st, 2012

CS 680: Assembly and Analysis of Sequencing Data. Fall 2012 August 21st, 2012 CS 680: Assembly and Analysis of Sequencing Data Fall 2012 August 21st, 2012 Logis@cs of the Course Logis@cs About the Course Instructor: Chris@na Boucher email: cboucher@cs.colostate.edu Office: CSB 464

More information

TEDDY Omics Data Availability

TEDDY Omics Data Availability Dietary Biomarkers Ascorbic Acid Result file Available, Final December 2015 1) Samples that did not pass the lab s QC were excluded from the 2) These data are considered the TEDDY standard for Ascorbic

More information

Accelerate precision medicine with Microsoft Genomics

Accelerate precision medicine with Microsoft Genomics Accelerate precision medicine with Microsoft Genomics Copyright 2018 Microsoft, Inc. All rights reserved. This content is for informational purposes only. Microsoft makes no warranties, express or implied,

More information