NGS sequence preprocessing. José Carbonell Caballero
|
|
- Elisabeth Norris
- 6 years ago
- Views:
Transcription
1 NGS sequence preprocessing José Carbonell Caballero
2 Contents Data Format Quality Control Sequence capture Fasta and fastq formats Sequence quality encoding Evaluation of sequence quality Quality control tools Identification of typical artifacts Sequence filtering Practical session 2
3 Sequence capture RAW data Propietary format FastQ 3
4 Different technologies 4
5 Genome sequencing Reference genome 5
6 Where we are? Sequence preprocessing NGS pipeline Mapping Variant calling Downstream analysis 6
7 Fasta and Fastq formats Standard formats for sequence storage Text-based formats (easy to use!) (Almost) every programming language has a parser 7
8 Fasta format Nucleotide or peptide sequence >gi gb AAD cytochrome b [Elephas maximus maximus] LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX IENY >BBTBSCRYR tgcaccaaacatgtctaaagctggaaccaaaattactttctttgaagacaaaaactttca aggccgccactatgacagcgattgcgactgtgcagatttccacatgtacctgagccgctg caactccatcagagtggaaggaggcacctgggctgtgtatgaaaggcccaattttgctgg gtacatgtacatcctaccccggggcgagtatcctgagtaccagcactggatgggcctcaa Some typical file extensions (.fasta,.fa,.fna,.ffn,.faa,...) 8
9 Fasta format Allow multi-sequence (typically different chromosomes) >scaffold_1 CAAGGCTATAGCCCACCCGTTTTTGTGGCCTTTTTCCGCTGGACGAACTTGGCGCCCCGGCCTTCGGGTGGTTATTTTTG GGTGCAGCCTAGTGCGCGGCCTATTTTTGGCACACGGAGGCCCCTCGCAAAGTCTCGCGGCATTCCGAGTCCGGCGGACG AAGTTGGCCAGCCCCACCCCCCAAGGCTATAGCCCACCCGTTTTTGTGGCTTTTTTCCGCTGGACGAACTTGGCGCCCCG GCCTTCGGGCGGTTATTTTTGGCCGCGGCTTCGTCCGTGGCCTATTTTTGGCACACGGAGGCCCCCCGCAAACTCTCCCG GCATTCCGAGTCCGGCGGACGAAGTCGGCCAGCTTCACCACCCAGGCTGTTGCCCACCCCTTTTTGTGGCCTTTTTCCGC TGGACGAACTTGGCGCCCCAGCCTTTGGGCTGTTATTTATGGGTGCGGCTTTGTCTACGGCCTATTTTTGGCAGACGCAG GCCCCTCGCAAAGTCTCGCGGCATTCCGAGTCCGGCGGACGAAGTCGGCCAGCCCCACCCCCCAAGGCTATAGCCCACCC GTTTTTGTGGCCTTTTTCCGCTGGACGAACTTGGCGCCCCGGCCTTCGGGCGGTTTTTTTCTGGTGCGGTTTTGCCCGCG GCCTATTTTTGGCACTTGGAGGCCCCTCGTAAAGTCTCGCGGCATTCCGAGTCCGGCGGAAGAAGTTGGCCAGCCCCACC CTCCAAGGCTATAGCCCACCCGTTTTTGTGGCCTTTTTCCGCTGGACGAACTTGGGGCCCCGGCCTTCGGGCGGTTATTT -- >scaffold_2 ACGGTCCGGGGGCATCGGGGTGGGGGGGTAGCCGCGCGGCAGTTTGAACGGCGAAAAATGGGCAAGATCGGGGGCCGCTT AGTAGGCTTTGCCGGTTTCGGCCGTAACTCATGATCCGGGCCTCCGATTCCGTTTCCGTTTGGTCCCACGGGACCAGCGG TCCGGGGGCATCGGCAAGGGGGGGTAGCCGTGCGGCGGTTTGATCGCCGAAAAATGGGTAAGATCGGGGCCGTTTGGCCC GTTTTGCCGGTTTCGGCCCCCCGGGGGGCGGTTCATGCCCCGGGGGGGACAGCGGGGCGGGATCGGCACACGGCGGGTGA GGTGATCGGGTTCAGGCGGGTGCGGTCGGCGGCGGGGGCGCCCGGGGGGCTATAGCGCACCGCCTCGGGGGCCGCAAATT GGGGGCCGTAACTCATGATCGGGGCCCCCGATTCCGTTTCCGTTTCGTACCACGGGACCAGCGGTCCGGGGGCATCGGGA TGGGGGGGTAGCCGCGCGGCAGTTTGAACGGCGAAAAATGGGAAAGATCGGGGGCCGCTTAGTAGGCTTTGCCGGTTTCG GCCGTAACTCATGATCCGGGCCTCCGATTCCGTTTCCGTTTGGTCCCACGGGACCAGCGGTCCGGGGGCATCGGGATGGG GGGGTAGCCGTGCGGCGGTTTGATCGCCGAAAAATGGGTAAGATCGGGGCCGTTTGGCCCGTTTTGCCGGTTTCGGCCCC CCGGGGGGCGGTTCATGCCCCGGGGGGCGGTTCATGCCCCGGGGGGGACAGCGGGGCGGGATCGGTACACGGCGGGGGAG -- >scaffold_21 ACATATATAAAGTATTGTACTAGAAAACATTGTAAATGTATGCCTATTTAAACTTCAAGTATATGTAACACTTTCAAAGT CATAAGTGTAAAACTATTATATTTAAGATGTTTTGAGTTTATAAAAATAAACAACTTAACACTTCTACTCAGACGTTAAA AAATAAAAAACAAACATATTATTCTAATATATACATTCATACCCACTTAGACTCATTCAAGTTTAAGATATAAAAAAAAA AAAAGTGCTACCTAGAAATCCTTAATAGCAAGTCTTGTCTTTTATTTCATTAAGGGTAAAATCCTAAATGTGGCAAATGG CGTGTTATAAGAATTTTTGAGGGGTGCCAAATGCCCAATTCATTCATATTAGGCTTCTGAAAGAAGGCCCATTCATTCAC GACTTCGGGTCGCCCACCTGCTTGAATCCGTTTGTGTTTTTAACGTTGCAAGTATACCCATGTAAGTAAAAACAAACAAA 9
10 Fastq format Let's say fastq is a fasta with GATTTGGGGTTCAAAGCAGTATCGATCAAATAGTAAATCCATTTGTTCAACTCACAGTTT +!''*((((***+))%%%++)(%%%%).1***-+*''))**55CCF>>>>>>CCCCCCC65 Fasta storages genomes...and fastq fragments 10
11 Sequence quality encoding Base quality must be encoded in just 1 GATTTGGGGTTCAAAGCAGTATCGATCAAATAGTAAATCCATTTGTTCAACTCACAGTTT +!''*((((***+))%%%++)(%%%%).1***-+*''))**55CCF>>>>>>CCCCCCC65 Each base has a corresponding quality value (quality in position n, corresponds to base of position n) How is the encoding? Error probability Phred transformation (inversed integer value) ASCII encoding 11
12 Sequence quality encoding Phred + 33 Sanger [0,40] Illumina 1.8 [0,41] Phred + 64 Illumina 1.3 [0,40] Illumina 1.5 [3,40] 12
13 Sequence quality encoding Phred scores 13
14 Sequence quality encoding Phred scores Error probability Phred transformation (inversed integer value) ASCII GATTTGGGGTTCAAAGCAGTATCGATCAAATAGTAAATCCATTTGTTCAACTCACAGTTT +!''*((((***+))%%%++)(%%%%).1***-+*''))**55CCF>>>>>>CCCCCCC65 P = 0.01 Q = -10*log10(0.01) = 20 Phred+33 ASCII = 53 => 5 P = 1 Q = -10*log10(0.01) = 0 Phred+33 ASCII 33+0 = 33 =>! 14
15 Evaluation of sequence quality Primary tool to assess sequencing If we evaluate our sequence quality in deep then we will known how reliable are our results QC determines posterior filtering We must be consistent with any filtering decision......if not, dowstream analysis will suffer the consequences QC must be test after every critical step 15
16 Evaluation of sequence quality How? quality per base Quality (or error probability) will be also a topic in next pipeline steps 16
17 Quality control tools FastQC 17
18 Quality control tools fastx-toolkit 18
19 Quality control tools NGS QC Toolkit 19
20 Quality control tools Example GOOD quality sequence_short_fastqc/fastqc_report.html POOR quality _sequence_fastqc/fastqc_report.html 20
21 Typical artifacts Sequence adapters 21
22 Typical artifacts Poor quality data 22
23 Typical artifacts Platform dependent 23
24 Sequence filtering (and editing) remove bad quality data Improve confidence of downstream analysis 24
25 Sequence filtering (and editing) Tail quality trimming minimum quality threshold 25
26 Sequence filtering (and editing) Mean quality Read length Read length after trimming Percentage of bases above Q Adapter trimming Adapter reads 26
27 Sequence filtering tools Fastx-toolkit Galaxy ( SeqTK ( Cutadapt ( And more... 27
28 Any question? 28
Francisco García Quality Control for NGS Raw Data
Contents Data formats Sequence capture Fasta and fastq formats Sequence quality encoding Quality Control Evaluation of sequence quality Quality control tools Identification of artifacts & filtering Practical
More informationBasic Bioinformatics: Homology, Sequence Alignment,
Basic Bioinformatics: Homology, Sequence Alignment, and BLAST William S. Sanders Institute for Genomics, Biocomputing, and Biotechnology (IGBB) High Performance Computing Collaboratory (HPC 2 ) Mississippi
More informationDATA FORMATS AND QUALITY CONTROL
HTS Summer School 12-16th September 2016 DATA FORMATS AND QUALITY CONTROL Romina Petersen, University of Cambridge (rp520@medschl.cam.ac.uk) Luigi Grassi, University of Cambridge (lg490@medschl.cam.ac.uk)
More informationBST 226 Statistical Methods for Bioinformatics David M. Rocke. March 10, 2014 BST 226 Statistical Methods for Bioinformatics 1
BST 226 Statistical Methods for Bioinformatics David M. Rocke March 10, 2014 BST 226 Statistical Methods for Bioinformatics 1 NGS Technologies Illumina Sequencing HiSeq 2500 & MiSeq PacBio Sequencing PacBio
More informationQuality assessment and control of sequence data. Naiara Rodríguez-Ezpeleta
Quality assessment and control of sequence data Naiara Rodríguez-Ezpeleta Workshop on Genomics 2014 Quality control is important Some of the artefacts/problems that can be detected with QC Sequencing Sequence
More informationData Basics. Josef K Vogt Slides by: Simon Rasmussen Next Generation Sequencing Analysis
Data Basics Josef K Vogt Slides by: Simon Rasmussen 2017 Generalized NGS analysis Sample prep & Sequencing Data size Main data reductive steps SNPs, genes, regions Application Assembly: Compare Raw Pre-
More informationQuality assessment and control of sequence data
Quality assessment and control of sequence data Naiara Rodríguez-Ezpeleta Workshop on Genomics 2015 Cesky Krumlov fastq format fasta Most basic file format to represent nucleotide or amino-acid sequences
More informationIllumina Sequencing Error Profiles and Quality Control
Illumina Sequencing Error Profiles and Quality Control RNA-seq Workflow Biological samples/library preparation Sequence reads FASTQC Adapter Trimming (Optional) Splice-aware mapping to genome Counting
More informationTwo Mark question and Answers
1. Define Bioinformatics Two Mark question and Answers Bioinformatics is the field of science in which biology, computer science, and information technology merge into a single discipline. There are three
More informationLecture 7. Next-generation sequencing technologies
Lecture 7 Next-generation sequencing technologies Next-generation sequencing technologies General principles of short-read NGS Construct a library of fragments Generate clonal template populations Massively
More informationSanger vs Next-Gen Sequencing
Tools and Algorithms in Bioinformatics GCBA815/MCGB815/BMI815, Fall 2017 Week-8: Next-Gen Sequencing RNA-seq Data Analysis Babu Guda, Ph.D. Professor, Genetics, Cell Biology & Anatomy Director, Bioinformatics
More informationBioinformatics for NGS projects. Guidelines. genomescan.nl
Next Generation Sequencing Bioinformatics for NGS projects Guidelines genomescan.nl GenomeScan s Guidelines for Bioinformatics Services on NGS Data Using our own proprietary data analysis pipelines Dear
More informationEcole de Bioinforma(que AVIESAN Roscoff 2014 GALAXY INITIATION. A. Lermine U900 Ins(tut Curie, INSERM, Mines ParisTech
GALAXY INITIATION A. Lermine U900 Ins(tut Curie, INSERM, Mines ParisTech How does Next- Gen sequencing work? DNA fragmentation Size selection and clonal amplification Massive parallel sequencing ACCGTTTGCCG
More informationGenomic DNA ASSEMBLY BY REMAPPING. Course overview
ASSEMBLY BY REMAPPING Laurent Falquet, The Bioinformatics Unravelling Group, UNIFR & SIB MA/MER @ UniFr Group Leader @ SIB Course overview Genomic DNA PacBio Illumina methylation de novo remapping Annotation
More informationRADseq Data Analysis Workshop 3 February 2017
RADseq Data Analysis Workshop 3 February 2017 Introduction to Galaxy (thanks to Simon Gladman for slides) What is Galaxy? A web-based scalable workflow platform for genomic analysis Designed for biologists
More informationWhy QC? Next-Generation Sequencing: Quality Control. Illumina data format. Fastq format:
Why QC? Next-Generation Sequencing: Quality Control BaRC Hot Topics January 2017 Bioinformatics and Research Computing Whitehead Institute Do you want to include the reads with low quality base calls?
More informationNext-Generation Sequencing: Quality Control
Next-Generation Sequencing: Quality Control Bingbing Yuan BaRC Hot Topics January 2017 Bioinformatics and Research Computing Whitehead Institute http://barc.wi.mit.edu/hot_topics/ Why QC? Do you want to
More informationNEXT GENERATION SEQUENCING. Farhat Habib
NEXT GENERATION SEQUENCING HISTORY HISTORY Sanger Dominant for last ~30 years 1000bp longest read Based on primers so not good for repetitive or SNPs sites HISTORY Sanger Dominant for last ~30 years 1000bp
More informationC3BI. VARIANTS CALLING November Pierre Lechat Stéphane Descorps-Declère
C3BI VARIANTS CALLING November 2016 Pierre Lechat Stéphane Descorps-Declère General Workflow (GATK) software websites software bwa picard samtools GATK IGV tablet vcftools website http://bio-bwa.sourceforge.net/
More informationLecture 2: Biology Basics Con4nued
Lecture 2: Biology Basics Con4nued Central Dogma DNA: The Code of Life The structure and the four genomic le=ers code for all living organisms Adenine, Guanine, Thymine, and Cytosine which pair A- T and
More informationQuality Control of Sequencing Data
Quality Control of Sequencing Data Surya Saha Sol Genomics Network (SGN) Boyce Thompson Institute, Ithaca, NY ss2489@cornell.edu // Twitter:@SahaSurya BTI Plant Bioinformatics Course 2015 Slides: Aureliano
More informationSequencing techniques
Sequencing techniques Workshop on Whole Genome Sequencing and Analysis, 2-4 Oct. 2017 Learning objective: After this lecture, you should be able to account for different techniques for whole genome sequencing
More informationDNA concentration and purity were initially measured by NanoDrop 2000 and verified on Qubit 2.0 Fluorometer.
DNA Preparation and QC Extraction DNA was extracted from whole blood or flash frozen post-mortem tissue using a DNA mini kit (QIAmp #51104 and QIAmp#51404, respectively) following the manufacturer s recommendations.
More informationExperimental Design. Sequencing. Data Quality Control. Read mapping. Differential Expression analysis
-Seq Analysis Quality Control checks Reproducibility Reliability -seq vs Microarray Higher sensitivity and dynamic range Lower technical variation Available for all species Novel transcript identification
More informationRNA-Seq Module 2 From QC to differential gene expression.
RNA-Seq Module 2 From QC to differential gene expression. Ying Zhang Ph.D, Informatics Analyst Research Informatics Support System (RISS) MSI Apr. 24, 2012 RNA-Seq Tutorials Tutorial 1: Introductory (Mar.
More informationNext-generation sequencing and quality control: An introduction 2016
Next-generation sequencing and quality control: An introduction 2016 s.schmeier@massey.ac.nz http://sschmeier.com/bioinf-workshop/ Overview Typical workflow of a genomics experiment Genome versus transcriptome
More informationNext Gen Sequencing. Expansion of sequencing technology. Contents
Next Gen Sequencing Contents 1 Expansion of sequencing technology 2 The Next Generation of Sequencing: High-Throughput Technologies 3 High Throughput Sequencing Applied to Genome Sequencing (TEDed CC BY-NC-ND
More informationDe Novo Assembly of High-throughput Short Read Sequences
De Novo Assembly of High-throughput Short Read Sequences Chuming Chen Center for Bioinformatics and Computational Biology (CBCB) University of Delaware NECC Third Skate Genome Annotation Workshop May 23,
More informationISO/IEC JTC 1/SC 29/WG 11 N15527 Warsaw, CH June Introduction
INTERNATIONAL ORGANISATION FOR STANDARDISATION ORGANISATION INTERNATIONALE DE NORMALISATION ISO/IEC JTC 1/SC 29/WG 11 CODING OF MOVING PICTURES AND AUDIO ISO/IEC JTC 1/SC 29/WG 11 N15527 Warsaw, CH June
More informationIntroductie en Toepassingen van Next-Generation Sequencing in de Klinische Virologie. Sander van Boheemen Medical Microbiology
Introductie en Toepassingen van Next-Generation Sequencing in de Klinische Virologie Sander van Boheemen Medical Microbiology Next-generation sequencing Next-generation sequencing (NGS), also known as
More informationIntroduction to NGS. Data Analysis
Introduction to NGS (Now Generation Sequencing) Data Analysis Alex Sánchez Statistics and Bioinformatics Research Group Statistics department, Universitat de Barelona Statistics and Bioinformatics Unit
More informationMapping Next Generation Sequence Reads. Bingbing Yuan Dec. 2, 2010
Mapping Next Generation Sequence Reads Bingbing Yuan Dec. 2, 2010 1 What happen if reads are not mapped properly? Some data won t be used, thus fewer reads would be aligned. Reads are mapped to the wrong
More informationDNASeq: Analysis pipeline and file formats Sumir Panji, Gerrit Boha and Amel Ghouila
DNASeq: Analysis pipeline and file formats Sumir Panji, Gerrit Boha and Amel Ghouila Bioinforma>cs analysis and annota>on of variants in NGS data workshop Cape Town, 4th to 6th April 2016 DNA Sequencing:
More informationNGS in Pathology Webinar
NGS in Pathology Webinar NGS Data Analysis March 10 2016 1 Topics for today s presentation 2 Introduction Next Generation Sequencing (NGS) is becoming a common and versatile tool for biological and medical
More informationDe Novo Assembly (Pseudomonas aeruginosa MAPO1 ) Sample to Insight
De Novo Assembly (Pseudomonas aeruginosa MAPO1 ) Sample to Insight 1 Workflow Import NGS raw data QC on reads De novo assembly Trim reads Finding Genes BLAST Sample to Insight Case Study Pseudomonas aeruginosa
More informationNUCLEIC ACIDS. DNA (Deoxyribonucleic Acid) and RNA (Ribonucleic Acid): information storage molecules made up of nucleotides.
NUCLEIC ACIDS DNA (Deoxyribonucleic Acid) and RNA (Ribonucleic Acid): information storage molecules made up of nucleotides. Base Adenine Guanine Cytosine Uracil Thymine Abbreviation A G C U T DNA RNA 2
More informationRead Quality Assessment & Improvement. UCD Genome Center Bioinformatics Core Tuesday 14 June 2016
Read Quality Assessment & Improvement UCD Genome Center Bioinformatics Core Tuesday 14 June 2016 QA&I should be interactive Error modes Each technology has unique error modes, depending on the physico-chemical
More informationAnalytics Behind Genomic Testing
A Quick Guide to the Analytics Behind Genomic Testing Elaine Gee, PhD Director, Bioinformatics ARUP Laboratories 1 Learning Objectives Catalogue various types of bioinformatics analyses that support clinical
More informationLecture 3: Biology Basics Con4nued. Spring 2017 January 24, 2017
Lecture 3: Biology Basics Con4nued Spring 2017 January 24, 2017 Genotype/Phenotype Blue eyes Phenotype: Brown eyes Recessive: bb Genotype: Dominant: Bb or BB Genes are shown in rela%ve order and distance
More informationQuality control for Sequencing Experiments
Quality control for Sequencing Experiments v2018-04 Simon Andrews simon.andrews@babraham.ac.uk Support service for bioinformatics Academic Babraham Institute Commercial Consultancy Support BI Sequencing
More informationGenome 373: Mapping Short Sequence Reads II. Doug Fowler
Genome 373: Mapping Short Sequence Reads II Doug Fowler The final Will be in this room on June 6 th at 8:30a Will be focused on the second half of the course, but will include material from the first half
More informationGenomics AGRY Michael Gribskov Hock 331
Genomics AGRY 60000 Michael Gribskov gribskov@purdue.edu Hock 331 Computing Essentials Resources In this course we will assemble and annotate both genomic and transcriptomic sequence assemblies We will
More informationGalaxy for Next Generation Sequencing 初探次世代序列分析平台 蘇聖堯 2013/9/12
Galaxy for Next Generation Sequencing 初探次世代序列分析平台 蘇聖堯 2013/9/12 What s Galaxy? Bringing Developers And Biologists Together. Reproducible Science Is Our Goal An open, web-based platform for data intensive
More informationCourse Presentation. Ignacio Medina Presentation
Course Index Introduction Agenda Analysis pipeline Some considerations Introduction Who we are Teachers: Marta Bleda: Computational Biologist and Data Analyst at Department of Medicine, Addenbrooke's Hospital
More informationIntroduction of RNA-Seq Analysis
Introduction of RNA-Seq Analysis Jiang Li, MS Bioinformatics System Engineer I Center for Quantitative Sciences(CQS) Vanderbilt University September 21, 2012 Goal of this talk 1. Act as a practical resource
More informationQuality assurance in NGS (diagnostics)
Quality assurance in NGS (diagnostics) Chris Mattocks National Genetics Reference Laboratory (Wessex) Research Diagnostics Quality assurance Any systematic process of checking to see whether a product
More informationBioinformatics small variants Data Analysis. Guidelines. genomescan.nl
Next Generation Sequencing Bioinformatics small variants Data Analysis Guidelines genomescan.nl GenomeScan s Guidelines for Small Variant Analysis on NGS Data Using our own proprietary data analysis pipelines
More informationDifferential gene expression analysis using RNA-seq
https://abc.med.cornell.edu/ Differential gene expression analysis using RNA-seq Applied Bioinformatics Core, March 2018 Friederike Dündar with Luce Skrabanek & Paul Zumbo Day 1: Introduction into high-throughput
More informationA step-by-step guide to ChIP-seq data analysis
A step-by-step guide to ChIP-seq data analysis December 03, 2014 Xi Chen, Ph.D. EMBL-European Bioinformatics Institute Wellcome Trust Sanger Institute Target audience Wet-lab biologists with no experience
More informationNext Generation Sequencing Lecture Saarbrücken, 19. March Sequencing Platforms
Next Generation Sequencing Lecture Saarbrücken, 19. March 2012 Sequencing Platforms Contents Introduction Sequencing Workflow Platforms Roche 454 ABI SOLiD Illumina Genome Anlayzer / HiSeq Problems Quality
More informationTranscriptomics analysis with RNA seq: an overview Frederik Coppens
Transcriptomics analysis with RNA seq: an overview Frederik Coppens Platforms Applications Analysis Quantification RNA content Platforms Platforms Short (few hundred bases) Long reads (multiple kilobases)
More informationEuropean Union Reference Laboratory for Genetically Modified Food and Feed (EURL GMFF)
Guideline for the submission of DNA sequences derived from genetically modified organisms and associated annotations within the framework of Directive 2001/18/EC and Regulation (EC) No 1829/2003 European
More informationDeep Sequencing technologies
Deep Sequencing technologies Gabriela Salinas 30 October 2017 Transcriptome and Genome Analysis Laboratory http://www.uni-bc.gwdg.de/index.php?id=709 Microarray and Deep-Sequencing Core Facility University
More informationUAB DNA-Seq Analysis Workshop. John Osborne Research Associate Centers for Clinical and Translational Science
+ UAB DNA-Seq Analysis Workshop John Osborne Research Associate Centers for Clinical and Translational Science ozborn@uab.,edu + Thanks in advance You are the Guinea pigs for this workshop! At this point
More informationComparing a few SNP calling algorithms using low-coverage sequencing data
Yu and Sun BMC Bioinformatics 2013, 14:274 RESEARCH ARTICLE Open Access Comparing a few SNP calling algorithms using low-coverage sequencing data Xiaoqing Yu 1 and Shuying Sun 1,2* Abstract Background:
More informationRNA-Seq de novo assembly training
RNA-Seq de novo assembly training Training session aims Give you some keys elements to look at during read quality check. Transcriptome assembly is not completely a strait forward process : Multiple strategies
More informationQIAseq Targeted Panel Analysis Plugin USER MANUAL
QIAseq Targeted Panel Analysis Plugin USER MANUAL User manual for QIAseq Targeted Panel Analysis 1.1 Windows, macos and Linux June 18, 2018 This software is for research purposes only. QIAGEN Aarhus Silkeborgvej
More informationNGS, Cancer and Bioinformatics. 5/3/2015 Yannick Boursin
NGS, Cancer and Bioinformatics 5/3/2015 Yannick Boursin 1 NGS and Clinical Oncology NGS in hereditary cancer genome testing BRCA1/2 (breast/ovary cancer) XPC (melanoma) ERCC1 (colorectal cancer) NGS for
More informationIntroduction to CGE tools
Introduction to CGE tools Pimlapas Leekitcharoenphon (Shinny) Research Group of Genomic Epidemiology, DTU-Food. WHO Collaborating Centre for Antimicrobial Resistance in Foodborne Pathogens and Genomics.
More informationSession 8. Differential gene expression analysis using RNAseq data
Functional and Comparative Genomics 2018 Session 8. Differential gene expression analysis using RNAseq data Tutors: Hrant Hovhannisyan, PhD student, email: grant.hovhannisyan@gmail.com Uciel Chorostecki,
More informationAnalysis of RNA-seq Data. Feb 8, 2017 Peikai CHEN (PHD)
Analysis of RNA-seq Data Feb 8, 2017 Peikai CHEN (PHD) Outline What is RNA-seq? What can RNA-seq do? How is RNA-seq measured? How to process RNA-seq data: the basics How to visualize and diagnose your
More informationSequencing technologies. Jose Blanca COMAV institute bioinf.comav.upv.es
Sequencing technologies Jose Blanca COMAV institute bioinf.comav.upv.es Outline Sequencing technologies: Sanger 2nd generation sequencing: 3er generation sequencing: 454 Illumina SOLiD Ion Torrent PacBio
More informationGENOME ASSEMBLY FINAL PIPELINE AND RESULTS
GENOME ASSEMBLY FINAL PIPELINE AND RESULTS Faction 1 Yanxi Chen Carl Dyson Sean Lucking Chris Monaco Shashwat Deepali Nagar Jessica Rowell Ankit Srivastava Camila Medrano Trochez Venna Wang Seyed Alireza
More informationApplications of short-read
Applications of short-read sequencing: RNA-Seq and ChIP-Seq BaRC Hot Topics March 2013 George Bell, Ph.D. http://jura.wi.mit.edu/bio/education/hot_topics/ Sequencing applications RNA-Seq includes experiments
More informationAn overhang-based DNA block shuffling method for creating a customized random library
An overhang-based DNA block shuffling method for creating a customized random library Kosuke Fujishima, Chris Venter, Kendrick Wang, Raphael Ferreira and Lynn J. Rothschild Supplementary figures and text:
More informationBIGpre: A Quality Assessment Package for Next-Generation Sequencing Data
GENOMICS PROTEOMICS & BIOINFORMATICS www.sciencedirect.com/science/journal/16720229 Application Note BIGpre: A Quality Assessment Package for Next-Generation Sequencing Data Tongwu Zhang 1,2, Yingfeng
More informationMEEPTOOLS: A maximum expected error based FASTQ read filtering and trimming toolkit
MEEPTOOLS: A maximum expected error based FASTQ read filtering and trimming toolkit Vishal N. Koparde 1* (vnkoparde@vcu.edu) Hardik I. Parikh 2 (parikhhi@vcu.edu) Steven P. Bradley 2 (bradleysp@vcu.edu)
More informationFrom raw reads to variants
From raw reads to variants Sebastian DiLorenzo Sebastian.DiLorenzo@NBIS.se Talk Overview Concepts Reference genome Variants Paired-end data NGS Workflow Quality control & Trimming Alignment Local realignment
More informationSupplementary Figures and Data
Supplementary Figures and Data Whole Exome Screening Identifies Novel and Recurrent WISP3 Mutations Causing Progressive Pseudorheumatoid Dysplasia in Jammu and Kashmir India Ekta Rai 1, Ankit Mahajan 2,
More informationParts of a standard FastQC report
FastQC FastQC, written by Simon Andrews of Babraham Bioinformatics, is a very popular tool used to provide an overview of basic quality control metrics for raw next generation sequencing data. There are
More informationNext Generation Sequencing: An Overview
Next Generation Sequencing: An Overview Cavan Reilly November 13, 2017 Table of contents Next generation sequencing NGS and microarrays Study design Quality assessment Burrows Wheeler transform Next generation
More informationAssignment 9: Genetic Variation
Assignment 9: Genetic Variation Due Date: Friday, March 30 th, 2018, 10 am In this assignment, you will profile genome variation information and attempt to answer biologically relevant questions. The variant
More informationSequencing applications. Today's outline. Hands-on exercises. Applications of short-read sequencing: RNA-Seq and ChIP-Seq
Sequencing applications Applications of short-read sequencing: RNA-Seq and ChIP-Seq BaRC Hot Topics March 2013 George Bell, Ph.D. http://jura.wi.mit.edu/bio/education/hot_topics/ RNA-Seq includes experiments
More informationDNBseq TM SERVICE OVERVIEW Plant and Animal Whole Genome Re-Sequencing
TM SERVICE OVERVIEW Plant and Animal Whole Genome Re-Sequencing Plant and animal whole genome re-sequencing (WGRS) involves sequencing the entire genome of a plant or animal and comparing the sequence
More informationChang Xu Mohammad R Nezami Ranjbar Zhong Wu John DiCarlo Yexun Wang
Supplementary Materials for: Detecting very low allele fraction variants using targeted DNA sequencing and a novel molecular barcode-aware variant caller Chang Xu Mohammad R Nezami Ranjbar Zhong Wu John
More informationIntroduction to Bioinformatics analysis of Metabarcoding data
Introduction to Bioinformatics analysis of Metabarcoding data Theoretical part Alvaro Sebastián Yagüe Experimental design Sampling Sample processing Sequencing Sequence processing Experimental design Sampling
More informationDifferential gene expression analysis using RNA-seq
https://abc.med.cornell.edu/ Differential gene expression analysis using RNA-seq Applied Bioinformatics Core, August 2017 Friederike Dündar with Luce Skrabanek & Ceyda Durmaz Day 1: Introduction into high-throughput
More informationRNA-Seq Analysis. Simon Andrews, Laura v
RNA-Seq Analysis Simon Andrews, Laura Biggins simon.andrews@babraham.ac.uk @simon_andrews v2018-10 RNA-Seq Libraries rrna depleted mrna Fragment u u u u NNNN Random prime + RT 2 nd strand synthesis (+
More informationRNA-seq data analysis with Chipster. Eija Korpelainen CSC IT Center for Science, Finland
RNA-seq data analysis with Chipster Eija Korpelainen CSC IT Center for Science, Finland chipster@csc.fi What will I learn? 1. What you can do with Chipster and how to operate it 2. What RNA-seq can be
More informationAstrocyte GCRB/BICF Workflow for ChIP-Seq Analysis. Venkat Beibei
Astrocyte GCRB/BICF Workflow for ChIP-Seq Analysis Venkat Malladi @GCRB Beibei Chen @BICF What%is%ChIP+Seq?% Chromatin immunoprecipitation followed by Sequencing (ChIP-Seq): Identify the binding sites
More informationNormal-Tumor Comparison using Next-Generation Sequencing Data
Normal-Tumor Comparison using Next-Generation Sequencing Data Chun Li Vanderbilt University Taichung, March 16, 2011 Next-Generation Sequencing First-generation (Sanger sequencing): 115 kb per day per
More informationRNA Seq: Methods and Applica6ons. Prat Thiru
RNA Seq: Methods and Applica6ons Prat Thiru 1 Outline Intro to RNA Seq Biological Ques6ons Comparison with Other Methods RNA Seq Protocol RNA Seq Applica6ons Annota6on Quan6fica6on Other Applica6ons Expression
More informationIntroduction to RNA sequencing
Introduction to RNA sequencing Bioinformatics perspective Olga Dethlefsen NBIS, National Bioinformatics Infrastructure Sweden November 2017 Olga (NBIS) RNA-seq November 2017 1 / 49 Outline Why sequence
More informationFast, Accurate and Sensitive DNA Variant Detection from Sanger Sequencing:
Fast, Accurate and Sensitive DNA Variant Detection from Sanger Sequencing: Patented, Anti-Correlation Technology Provides 99.5% Accuracy & Sensitivity to 5% Variant Knowledge Base and External Annotation
More informationHerramientas para el diseño y el análisis de datos de paneles de genes
Herramientas para el diseño y el análisis de datos de paneles de genes Hospital Sant Pau Barcelona, 16 Jun 2016 BIER Francisco García fgarcia@cipf.es Departamento de Genómica Computacional. CIPF Príncipe
More informationExperimental Design Microbial Sequencing
Experimental Design Microbial Sequencing Matthew L. Settles Genome Center Bioinformatics Core University of California, Davis settles@ucdavis.edu; bioinformatics.core@ucdavis.edu General rules for preparing
More informationFaction 2: Genome Assembly Lab and Preliminary Data
Faction 2: Genome Assembly Lab and Preliminary Data [Computational Genomics 2017] Christian Colon, Erisa Sula, David Lu, Tian Jin, Lijiang Long, Rohini Mopuri, Bowen Yang, Saminda Wijeratne, Harrison Kim
More informationRead Mapping and Variant Calling. Johannes Starlinger
Read Mapping and Variant Calling Johannes Starlinger Application Scenario: Personalized Cancer Therapy Different mutations require different therapy Collins, Meredith A., and Marina Pasca di Magliano.
More informationBionano Solve v3.0.1 Release Notes
Bionano Solve v3.0.1 Release Notes Document Number: 30157 Document Revision: B For Research Use Only. Not for use in diagnostic procedures. Copyright 2017 Bionano Genomics, Inc. All Rights Reserved. Table
More informationVALIDATION OF HLA TYPING BY NGS
VALIDATION OF HLA TYPING BY NGS Eric T. Weimer, Ph.D., D(ABMLI) Assistant Professor, Pathology and Laboratory Medicine Associate Director, Clinical Flow Cytometry, HLA, and Immunology Laboratories CONFLICT
More information2nd (Next) Generation Sequencing 2/2/2018
2nd (Next) Generation Sequencing 2/2/2018 Why do we want to sequence a genome? - To see the sequence (assembly) To validate an experiment (insert or knockout) To compare to another genome and find variations
More informationCBC Data Therapy. Metagenomics Discussion
CBC Data Therapy Metagenomics Discussion General Workflow Microbial sample Generate Metaomic data Process data (QC, etc.) Analysis Marker Genes Extract DNA Amplify with targeted primers Filter errors,
More informationZika infected human samples
Lecture 16 RNA-seq Zika infected human samples Experimental design ZIKV-infected hnpcs 56 hours after ZIKA and mock infection in parallel cultures were used for global transcriptome analysis. RNA-seq libraries
More informationSMRT Analysis Barcoding Overview
SMRT Analysis Barcoding Overview Introduction This document is for users with Sequel Systems using SMRT Link v5.0.0 or v5.0.1. This document covers: Barcoding designs, strategies and modes for preparing
More informationIntroduction to bioinformatics (NGS data analysis)
Introduction to bioinformatics (NGS data analysis) Alexander Jueterbock 2015-06-02 1 / 45 Got your sequencing data - now, what to do with it? File size: several Gb Number of lines: >1,000,000 @M02443:17:000000000-ABPBW:1:1101:12675:1533
More informationIntroduction to DNA-Sequencing
informatics.sydney.edu.au sih.info@sydney.edu.au The Sydney Informatics Hub provides support, training, and advice on research data, analyses and computing. Talk to us about your computing infrastructure,
More informationN ext-generation sequencing (NGS) technologies have become common practice in life science1. Benefited
OPEN SUBJECT AREAS: DATA PROCESSING HIGH-THROUGHPUT SCREENING BIOINFORMATICS Received 31 July 2014 Accepted 20 October 2014 Published 7 November 2014 Correspondence and requests for materials should be
More informationCS 680: Assembly and Analysis of Sequencing Data. Fall 2012 August 21st, 2012
CS 680: Assembly and Analysis of Sequencing Data Fall 2012 August 21st, 2012 Logis@cs of the Course Logis@cs About the Course Instructor: Chris@na Boucher email: cboucher@cs.colostate.edu Office: CSB 464
More informationTEDDY Omics Data Availability
Dietary Biomarkers Ascorbic Acid Result file Available, Final December 2015 1) Samples that did not pass the lab s QC were excluded from the 2) These data are considered the TEDDY standard for Ascorbic
More informationAccelerate precision medicine with Microsoft Genomics
Accelerate precision medicine with Microsoft Genomics Copyright 2018 Microsoft, Inc. All rights reserved. This content is for informational purposes only. Microsoft makes no warranties, express or implied,
More information