Cell culture and drug treatment. HEK 293 cells were cultured in DMEM (Gibco-BRL)
|
|
- Raymond Rich
- 5 years ago
- Views:
Transcription
1 Supplementary materials Detailed methods Cell culture and drug treatment. HEK 293 cells were cultured in DMEM (Gibco-BRL) supplemented with 10% fetal bovine serum. To inhibit glucosidase Ι and ΙΙ, castanospermine (Sigma) was added to a final concentration of 1 mm 1 h prior to pulselabeling. The proteasome inhibitor, lactacystin (Kyowa medics Co.), was added to the culture medium to a final concentration of 1 mm 4 h prior to pulse labeling. The inhibitors were also present in the medium during the pulse and chase periods. To inhibit glucosidase ΙΙ, N-butyl-deoxynojirimysin (Wako) was added to a final concentration of 1 mm at the time point of chase 5 min. Plasmid construction and transfection. EDEM-HA, A1AT (NHK), CNX-HA, and CRT/CNXtm were constructed as previously described (1, 2). FS-CNX was a kind gift from Dr. D. B. Williams (3). EDEM-myc was constructed by subcloning EDEM-HA into the Kpn Ι and Xho Ι sites of the pcdna3.1/myc-his(+)a vector (Invitrogen). Using PCR, the HA tag and TGA of EDEM-HA were deleted and a Xho Ι site was introduced at the C- terminus. CNX/HAtm was constructed as follows: the transmembrane region of
2 haemagglutinin was fused to FS-CNX followed by the HA tag and KKXX. The membrane region of HA was subcloned into the Dsa Ι and BamH Ι sites of FS-CNX. FS-CNX+HAtm was subcloned into the Hind ΙΙΙ and EcoR Ι sites of pcdna3.1, and the HA tag (YPYDVPDYA) and a retention signal (DEKKMQ) were introduced by PCR. The Fugene6 transfection reagent (Roche) was used for plasmid transfections 36 h prior to performing the pulse-chase assays. Metabolic labeling, immunoprecipitation and immunoblotting. Cells were labeled with EXPRESS 35 S protein labeling mixture (NEN) in methionine-free medium (Gibco-BRL), and chased in medium containing excess methionine. Cells were lysed in a buffer containing 1% NP-40, 150 mm NaCl, 50 mm Tris-Cl (ph 8.0) and protease inhibitors (1 mm N-methyl maleimide, 1 mm phenylmethylsulphonyl fluoride, 1 µg/ml leupeptin, 1 µg/ml pepstatin A). Lysates were immunoprecipitated using appropriate antibodies and coupled to protein A or G sepharose beads (Amersham Pharmacia). The beads were washed in high ionic extraction buffer (1% NP-40, 400 mm NaCl, 50 mm Tris-Cl (ph 8.0)) twice, and in 10 mm Tris-Cl (ph 7.4), eluted in Laemmli buffer, and resolved by SDS-PAGE. Gels were fixed with 50% TCA, washed, and enhanced with 1 M sodium salicylate. Radioactivity was quantified by exposing the gels to a phosphoimager (Strom, Amersham
3 Pharmacia) and the gels afterward were exposed to X-ray films. For western blotting, proteins were resolved by SDS-PAGE and transferred to nitrocellulose membranes followed by ECL (Amersham Pharmacia). Antibodies. For immunoprecipitation, antibodies specific for CNX (Stressgen SPA-860), CRT (Stressgen and ABR), HA (SantaCruz), A1AT (Dako), and EDEM antibody were used. Anti-EDEM antibodies were generated by immunizing rabbits with a synthetic peptide (ERDQEEKFVHRPKSQE). Western blotting was performed using antibodies to myc (9E10, SantaCruz) and CNX antibody (Stressgen SPA-860).
4 References 1. N. Hosokawa et al., EMBO Rep. 2, 415 (2001). 2. I. Wada, S. Imai, M. Kai, F. Sakane, H. Kanoh, J. Biol. Chem. 270, (1995). 3. U. G. Danilczk, M. F. Cohen-Doyle, D. B. Williams, J. Biol. Chem. 275, (2000). 4. J. Wang, A. L. White, Biochemistry 39, 8993 (2000) 5. K.S. Cannon, A. Helenius J. Biol. Chem. 274, 7537 (1999) Supplemetal figure legends Supplemental Figure 1. The effects of overexpressing CNX. HEK 293 cells were pulselabeled for 15 min and chased the periods indicated, immunoprecipitation was performed with anti-a1at antibody. Left panel: Cells were transfected with NHK or co-transfected with NHK and CNX-HA. Right panel: Cells were co-transfected with NHK and EDEMmyc or with NHK, EDEM-myc, and CNX-HA. Supplemental Figure 2. Post-translational inhibition of NHK glucose trimming retarded degradation. HEK 293 cells were transfected with NHK (supplementary Fig. 2A) or co-
5 transfected with NHK and EDEM (supplementary Fig. 2B), pulse-labeled for 15 min with [ 35 S]-methionine, and chased for the periods indicated. To inhibit trimming the Glu 1 into the Glu 0 form of NHK by glucosidase ΙΙ, cells were treated with N-butyl-deoxynojirimysin (BDNM) after 15 min pulse in the absence of the drug. Under this condition, release of NHK from CNX was prevented (4, 5).
6
7
Supplemental Online Material. The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/-
#1074683s 1 Supplemental Online Material Materials and Methods Cell lines and tissue culture The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/- knock-out animals
More informationSupplementary data. sienigma. F-Enigma F-EnigmaSM. a-p53
Supplementary data Supplemental Figure 1 A sienigma #2 sienigma sicontrol a-enigma - + ++ - - - - - - + ++ - - - - - - ++ B sienigma F-Enigma F-EnigmaSM a-flag HLK3 cells - - - + ++ + ++ - + - + + - -
More informationRNA oligonucleotides and 2 -O-methylated oligonucleotides were synthesized by. 5 AGACACAAACACCAUUGUCACACUCCACAGC; Rand-2 OMe,
Materials and methods Oligonucleotides and DNA constructs RNA oligonucleotides and 2 -O-methylated oligonucleotides were synthesized by Dharmacon Inc. (Lafayette, CO). The sequences were: 122-2 OMe, 5
More informationProtocol for induction of expression and cell lysate production
Protocol for induction of expression and cell lysate production AV-04 Doxycyclin induction and cell lysate 1.0 Introduction / Description This method is intended for the treatment of the previously transfected
More informationAntibodies against PCNA were previously described [1]. To deplete PCNA from Xenopus egg
Supplementary information Supplementary methods PCNA antibody and immunodepletion Antibodies against PCNA were previously described [1]. To deplete PCNA from Xenopus egg extracts, one volume of protein
More informationDescription of supplementary material file
Description of supplementary material file In the supplementary results we show that the VHL-fibronectin interaction is indirect, mediated by fibronectin binding to COL4A2. This provides additional information
More informationSupplementary methods
Supplementary methods Cell culture, infection, transfection, and RNA interference HEK293 cells and its derivatives were grown in DMEM supplemented with 10% FBS. Various constructs were introduced into
More informationSOD1 as a Molecular Switch for Initiating the Homeostatic ER Stress Response under Zinc Deficiency
Molecular Cell, Volume 52 Supplemental Information SOD1 as a Molecular Switch for Initiating the Homeostatic ER Stress Response under Zinc Deficiency Kengo Homma, Takao Fujisawa, Naomi Tsuburaya, Namiko
More informationEXPERIMENTAL PROCEDURES
EXPERIMENTAL PROCEDURES Cell culture and antibodies-human colorectal cancer HCT-116 cells, human embryonic kidney 293 cells and human normal breast epithelial cells MCF-10A cells were cultured as recommended
More informationSUPPLEMENTARY INFORMATION
The Supplementary Information (SI) Methods Cell culture and transfections H1299, U2OS, 293, HeLa cells were maintained in DMEM medium supplemented with 10% fetal bovine serum. H1299 and 293 cells were
More informationProtein Translation Study Label Protein with S35 Methionine in Cells Salma Hasan and Isabelle Plo *
Protein Translation Study Label Protein with S35 Methionine in Cells Salma Hasan and Isabelle Plo * INSERM U1009, Gustave Roussy, Villejuif, France *For correspondence: isabelle.plo@gustaveroussy.fr [Abstract]
More informationAnalysing protein protein interactions using a GST-fusion protein to pull down the interacting target from the cell lysate Hong Wang and Xin Zeng
Analysing protein protein interactions using a GST-fusion protein to pull down the interacting target from the cell lysate Hong Wang and Xin Zeng Department of Molecular Genetics, Biochemistry and Microbiology,
More informationSupplementary Materials and Methods
Supplementary Materials and Methods sirna sequences used in this study The sequences of Stealth Select RNAi for ALK and FLOT-1 were as follows: ALK sense no.1 (ALK): 5 -AAUACUGACAGCCACAGGCAAUGUC-3 ; ALK
More informationSupplementary information
Supplementary information Table of Content: Supplementary Results... 2 Supplementary Figure S1: Experimental validation of AP-MS results by coimmunprecipitation Western blot analysis.... 3 Supplementary
More informationSupplementary Material
Supplementary Material Supplementary Methods Cell synchronization. For synchronized cell growth, thymidine was added to 30% confluent U2OS cells to a final concentration of 2.5mM. Cells were incubated
More informationAnti-Pim-1 (Cat#3247), anti-met (Cat#3127), anti-ron (Cat#2654), Anti-EGFR
Supplementary Methods Antibodies Anti-Pim-1 (Cat#3247), anti-met (Cat#3127), anti-ron (Cat#2654), Anti-EGFR (Cat#2646), anti-igf1r (Cat#3018), anti-insr (Cat#3020), anti-akt (pan, Cat#4691), anti-phospho-akt
More informationSupplementary Information: Materials and Methods. Immunoblot and immunoprecipitation. Cells were washed in phosphate buffered
Supplementary Information: Materials and Methods Immunoblot and immunoprecipitation. Cells were washed in phosphate buffered saline (PBS) and lysed in TNN lysis buffer (50mM Tris at ph 8.0, 120mM NaCl
More informationSupplemental Information
Supplemental Information Intrinsic protein-protein interaction mediated and chaperonin assisted sequential assembly of a stable Bardet Biedl syndome protein complex, the BBSome * Qihong Zhang 1#, Dahai
More informationall samples of a band with a molecular weight close to that expected for the endogenous!-
SUPPLEMENTAL FIGURE LEGENDS Supplemental Figure 1 : Specificity of anti-!-arrestin Abs and levels of!-arrestin in WHIM wt leukocytes. (A and B) HEK 293T cells were transiently transfected using the reagent
More informationIgG TrueBlot Protocol for Mouse, Rabbit or Goatderived Antibodies - For Research Use Only
IgG TrueBlot Protocol for Mouse, Rabbit or Goatderived Antibodies - For Research Use Only Introduction The IgG TrueBlot for mouse, rabbit, or goat-derived antibodies represents unique series of respective
More informationLINGO-1, A TRANSMEMBRANE SIGNALING PROTEIN, INHIBITS OLIGODENDROCYTE DIFFERENTIATION AND MYELINATION THROUGH INTERCELLULAR SELF- INTERACTIONS.
Supplemental Data: LINGO-1, A TRANSMEMBRANE SIGNALING PROTEIN, INHIBITS OLIGODENDROCYTE DIFFERENTIATION AND MYELINATION THROUGH INTERCELLULAR SELF- INTERACTIONS. Scott Jepson, Bryan Vought, Christian H.
More informationGα i Activation Assay Kit
A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Gα i Activation Assay Kit Catalog Number 80301 20 assays NewEast Biosciences, Inc 1 Table of Content Product
More informationUbiquitin (76 aa) UB genes encode linear fusions of UB either to itself (poly-ub genes) or to other proteins these fusions are cleaved by
Ubiquitin (76 aa) UB genes encode linear fusions of UB either to itself (poly-ub genes) or to other proteins these fusions are cleaved by deubiquitylases (DUBs) yielding mature Ub deubiquitylase FLAG 3
More informationSupplemental Materials and Methods
Supplemental Materials and Methods In situ hybridization In situ hybridization analysis of HFE2 and genin mrna in rat liver tissues was performed as previously described (1). Briefly, the digoxigenin-labeled
More informationT H E J O U R N A L O F C E L L B I O L O G Y
T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Han et al., http://www.jcb.org/cgi/content/full/jcb.201311007/dc1 Figure S1. SIVA1 interacts with PCNA. (A) HEK293T cells were transiently
More informationCell extracts and western blotting RNA isolation and real-time PCR Chromatin immunoprecipitation (ChIP)
Cell extracts and western blotting Cells were washed with ice-cold phosphate-buffered saline (PBS) and lysed with lysis buffer. 1 Total cell extracts were separated by SDS-PAGE and transferred to nitrocellulose
More informationSupplementary Figures 1-12
Supplementary Figures 1-12 Supplementary Figure 1. The specificity of anti-abi1 antibody. Total Proteins extracted from the wild type seedlings or abi1-3 null mutant seedlings were used for immunoblotting
More informationSupplemental Data. LMO4 Controls the Balance between Excitatory. and Inhibitory Spinal V2 Interneurons
Neuron, Volume 61 Supplemental Data LMO4 Controls the Balance between Excitatory and Inhibitory Spinal V2 Interneurons Kaumudi Joshi, Seunghee Lee, Bora Lee, Jae W. Lee, and Soo-Kyung Lee Supplemental
More informationLong-lived protein degradation assay
Long-lived protein degradation assay Shun Kageyama, Takashi Ueno, Masaaki Komatsu METHOD Pulse and chase 1. Seed cells in 24-well plates in regular medium supplemented with 10% (v/v) heat-inactivated FBS
More informationThe following antibodies were used in this study: NuMA - rabbit-anti NuMA (gift from
Materials and Methods Antibodies: The following antibodies were used in this study: NuMA - rabbit-anti NuMA (gift from D. A. Compton); Dynein Intermediate Chain - 74.1 (Chemicon, Temecula, CA); Dynein
More informationChromatin Immunoprecipitation (ChIP)
de Lange Lab Chromatin Immunoprecipitation (ChIP) Required Solutions IP Wash A 0.1% SDS 1% Triton X-100 2 mm EDTA ph 8.0 20 mm Tris-HCl ph 8.0 150 mm NaCl 1 mm PMSF 1 µg/ml Leupeptin 1 µg/ml Aprotinin
More information15 June 2011 Supplementary material Bagriantsev et al.
Supplementary Figure S1 Characterization of K 2P 2.1 (TREK-1) GOF mutants A, Distribution of the positions of mutated nucleotides, represented by a red x, from a pool of 18 unselected K 2P 2.1 (KCNK2)
More informationSupplemental Information: Phosphorylation of CLIP-170 by Both Plk1 and CK2 Is Involved in the Timely Formation of Kinetochore-microtubule Attachments
Supplemental Information: Phosphorylation of CLIP-170 by Both Plk1 and CK2 Is Involved in the Timely Formation of Kinetochore-microtubule Attachments Hongchang Li, X. Shawn Liu, Xiaoming Yang, Yingmin
More informationsupplementary information
DOI: 10.1038/ncb1864 Figure S1 Apak specifically inhibits p53 transcriptional activity. Transcription activity of p53 was measured in U2OS (p53 wild-type) and H1299 (p53 deficient) cells which were transfected
More informationMechanism of Induction and Suppression of Antiviral Immunity Directed by Virus-Derived Small RNAs in Drosophila
Cell Host & Microbe, Volume 4 Supplemental Data Mechanism of Induction and Suppression of Antiviral Immunity Directed by Virus-Derived Small RNAs in Drosophila Roghiyh Aliyari, Qingfa Wu, Hong-Wei Li,
More informationReliaBLOT TM. IP/Western Blot Reagents Cat. No. WB120, rabbit
ReliaBLOT TM Introduction: IP/Western Blot Reagents Cat. No. WB120, rabbit ReliaBLOT TM IP/Western Blot Reagents and Procedures (patent pending) provide an improved method for the detection of immunoprecipitated
More informationASPP1 Fw GGTTGGGAATCCACGTGTTG ASPP1 Rv GCCATATCTTGGAGCTCTGAGAG
Supplemental Materials and Methods Plasmids: the following plasmids were used in the supplementary data: pwzl-myc- Lats2 (Aylon et al, 2006), pretrosuper-vector and pretrosuper-shp53 (generous gift of
More informationSupplementary material for: Materials and Methods:
Supplementary material for: Iron-responsive degradation of iron regulatory protein 1 does not require the Fe-S cluster: S.L. Clarke, et al. Materials and Methods: Fe-S Cluster Reconstitution: Cells treated
More informationSupplementary Figure S1 Purification of deubiquitinases HEK293 cells were transfected with the indicated DUB-expressing plasmids.
Supplementary Figure S1 Purification of deubiquitinases HEK293 cells were transfected with the indicated DUB-expressing plasmids. The cells were harvested 72 h after transfection. FLAG-tagged deubiquitinases
More informationShort hairpin RNA (shrna) against MMP14. Lentiviral plasmids containing shrna
Supplemental Materials and Methods Short hairpin RNA (shrna) against MMP14. Lentiviral plasmids containing shrna (Mission shrna, Sigma) against mouse MMP14 were transfected into HEK293 cells using FuGene6
More informationSupporting Information
Supporting Information Su et al. 10.1073/pnas.1211604110 SI Materials and Methods Cell Culture and Plasmids. Tera-1 and Tera-2 cells (ATCC: HTB- 105/106) were maintained in McCoy s 5A medium with 15% FBS
More informationSUPPLEMENTARY INFORMATION
R2A MASNSEKNPLL-SDEKPKSTEENKSS-KPESASGSSTSSAMP---GLNFNAFDFSNMASIL 56 R2B MASSSEKTPLIPSDEKNDTKEESKSTTKPESGSGAPPSPS-PTDPGLDFNAFDFSGMAGIL 60 R2A NDPSIREMAEQIAKDPAFNQLAEQLQRSIPNAGQEGGFPNFDPQQYVNTMQQVMHNPEFK
More informationSUPPLEMENTARY INFORMATION FIGURE 1 - 1
SUPPLEMENTARY INFORMATION FIGURE 1-1 SUPPLEMENTARY INFORMATION FIGURE 2-2 SUPPLEMENTARY INFORMATION METHODS GST-Pull-Down. Cultures of E. Coli (BL21) were transformed with pgex (Clontech) and pgex recombinant
More informationFor Research Use Only. Not for use in diagnostic procedures.
Printed December 13, 2011 Version 1.0 For Research Use Only. Not for use in diagnostic procedures. DDDDK-tagged Protein PURIFICATION GEL with Elution Peptide (MoAb. clone FLA-1) CODE No. 3326 / 3327 PURIFICATION
More informationSupplemental Materials and Methods
Supplemental Materials and Methods Co-immunoprecipitation (Co-IP) assay Cells were lysed with NETN buffer (20 mm Tris-HCl, ph 8.0, 0 mm NaCl, 1 mm EDT, 0.5% Nonidet P-40) containing 50 mm β-glycerophosphate,
More informationRab5 Activation Assay Kit
A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Rab5 Activation Assay Kit Catalog Number: 83701 20 assays 24 Whitewoods Lane 1 Table of Content Product
More informationArf6 Activation Assay Kit
A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Arf6 Activation Assay Kit Catalog Number: 82401 20 assays NewEast Biosciences 1 Table of Content Product
More informationAnti-HB-EGF (Human) mab
Page 1 For Research Use Only. Not for use in diagnostic procedures. CODE No. D308-3 Anti-HB-EGF (Human) mab CLONALITY CLONE ISOTYPE QUANTITY SOURCE IMMUNOGEN FORMURATION STORAGE Monoclonal 3H4 Mouse IgG1
More informationSUPPLEMENTARY INFORMATION
Figure S1 UVRAG amino acid sequence. Bold letters indicate the peptides identified from mass spectrometry analysis. Symbols indicate the prolines in the N-terminal proline-rich sequence (*), the C2 domain
More informationProtocol(Research use only)
Immunohistochemistry (without pretreatment) p2 Immunohistochemistry (Microwave pretreatment) p3 Immunohistochemistry (Autoclave pretreatment) p4 Immunohistochemistry (Trypsin pretreatment) p5 Immunohistochemistry
More informationSupplementary Fig.1 Luton
Supplementary Fig.1 Luton a 175 Brain Thymus Spleen Small Intestine Kidney Testis HeLa b 250 Lung Kidney MDCK c EFA6B si Control si Mismatch #637 #1564 #1770 83 62 47.5 175 IB: anti-efa6b #B1 130 66 Lysates
More informationTo examine the silencing effects of Celsr3 shrna, we co transfected 293T cells with expression
Supplemental figures Supplemental Figure. 1. Silencing expression of Celsr3 by shrna. To examine the silencing effects of Celsr3 shrna, we co transfected 293T cells with expression plasmids for the shrna
More informationRheB Activation Assay Kit
A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based RheB Activation Assay Kit Catalog Number: 81201 20 assays NewEast Biosciences 1 FAX: 610-945-2008 Table
More informationGα 13 Activation Assay Kit
A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Gα 13 Activation Assay Kit Catalog Number: 80401 20 assays NewEast Biosciences 1 Table of Content Product
More informationSupplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling
Supplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling Glendining KA 1, Markie D 2, Gardner RJM 4, Franz EA 3, Robertson SP 4, Jasoni CL 1 Supplementary
More informationinvasion and motility
Supplementary Data Maria José Oliveira, Jozef Van Damme, Tineke Lauwaet, Veerle De Corte, Georges De Bruyne, Gerda Verschraegen, Mario Vaneechoutte, Marc Goethals, Mohammad Reza Ahmadian, Oliver Müller,
More informationCdc42 Activation Assay Kit
A helping hand for your research Product Manual Configuration-specific Monoclonal Antibody Based Cdc42 Activation Assay Kit Catalog Number: 80701 20 assays 1 Table of Content Product Description 3 Assay
More informationImmunoprecipitation Protocol
Immunoprecipitation Protocol Immunoprecipitation is a general method to obtain the enrichment of a specific protein from tissue lysate and cell lysate. It can be used to purify a specific protein, to identify
More informationSupplemental Data Supplementary Figure Legends and Scheme Figure S1.
Supplemental Data Supplementary Figure Legends and Scheme Figure S1. UTK1 inhibits the second EGF-induced wave of lamellipodia formation in TT cells. A and B, EGF-induced lamellipodia formation in TT cells,
More informationLuo et al. Supplemental Figures and Materials and Methods
Luo et al. Supplemental Figures and Materials and Methods The supplemental figures demonstrate that nuclear NFAT is situated at PODs, overexpressed PML does not increase NFAT nuclear localization, and
More informationsupplementary information
DOI: 1.138/ncb1839 a b Control 1 2 3 Control 1 2 3 Fbw7 Smad3 1 2 3 4 1 2 3 4 c d IGF-1 IGF-1Rβ IGF-1Rβ-P Control / 1 2 3 4 Real-time RT-PCR Relative quantity (IGF-1/ mrna) 2 1 IGF-1 1 2 3 4 Control /
More informationT H E J O U R N A L O F C E L L B I O L O G Y
T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Nakajima and Tanoue, http://www.jcb.org/cgi/content/full/jcb.201104118/dc1 Figure S1. DLD-1 cells exhibit the characteristic morphology
More informationTranscriptional regulation of BRCA1 expression by a metabolic switch: Di, Fernandez, De Siervi, Longo, and Gardner. H3K4Me3
ChIP H3K4Me3 enrichment.25.2.15.1.5 H3K4Me3 H3K4Me3 ctrl H3K4Me3 + E2 NS + E2 1. kb kb +82 kb Figure S1. Estrogen promotes entry of MCF-7 into the cell cycle but does not significantly change activation-associated
More informationSUPPLEMENTARY INFORMATION
Supplementary Methods Protein expression and in vitro binding studies. Recombinant baculovirus carrying GST, GST-mCC, GST-mSec, GST-mSecA and GST-mSecD were generated according to the manufacturer s instructions
More informationSupporting Online Material for
www.sciencemag.org/cgi/content/full/323/5910/124/dc1 Supporting Online Material for Regulation of Neuronal Survival Factor MEF2D by Chaperone-Mediated Autophagy Qian Yang, Hua She, Marla Gearing, Emanuela
More informationAnna A. Sablina, Wen Chen, Jason D. Arroyo, Laura Corral, Melissa Hector, Sara E. Bulmer, James A. DeCaprio, and William C. Hahn
Cell, Volume 129 Supplemental Data The Tumor Suppressor PP2A Aβ Regulates the RalA GTPase Anna A. Sablina, Wen Chen, Jason D. Arroyo, Laura Corral, Melissa Hector, Sara E. Bulmer, James A. DeCaprio, and
More informationSupplementary Table 1. The Q-PCR primer sequence is summarized in the following table.
Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table. Name Sequence (5-3 ) Application Flag-u ggactacaaggacgacgatgac Shared upstream primer for all the amplifications of
More informationSupporting Information
Supporting Information Krieg et al. 10.1073/pnas.0907131106 SI Text Reagents. Recombinant human TNF- was from Peprotech. Monoclonal rat anti-rip2 was purchased from Alexis, whereas monoclonal mouse anti-xiap
More informationKinase Reaction and Alkylation Protocol
Kinase Reaction and Alkylation Protocol Protocol for the treatment of substrates prior to detection by Thiophosphate Ester antibodies This product is for research use only and is not intended for diagnostic
More informationtranscription and the promoter occupancy of Smad proteins. (A) HepG2 cells were co-transfected with the wwp-luc reporter, and FLAG-tagged FHL1,
Supplementary Data Supplementary Figure Legends Supplementary Figure 1 FHL-mediated TGFβ-responsive reporter transcription and the promoter occupancy of Smad proteins. (A) HepG2 cells were co-transfected
More informationThe P53 negative human lung carcinoma cell line H1299, the T-cell lymphoma EL4 and the
Materials and Methods Cell culture and transient transfection The P53 negative human lung carcinoma cell line H1299, the T-cell lymphoma EL4 and the CD8 + B3Z cells was cultured in RPMI 1640 supplemented
More informationCulture media, trypsin, penicillin and streptomycin were from Invitrogen (Breda, the Netherlands).
Methods Materials Culture media, trypsin, penicillin and streptomycin were from Invitrogen (Breda, the Netherlands). Bovine fibroblast growth factor (BFGF), thrombin, forskolin, IBMX, H-89, BAPTA-AM and
More informationProtocol Immunprecipitation
1 Protocol Immunprecipitation IP Juni 08, S.L. Before starting an IP on should be certain, that one can clearly detect the Protein to precipitate in a standard Western Blot with the lysis conditions used
More informationApoptosis And Anti-tumor Effect Induced By Mtor Inhibitor And Autophagy Inhibitor In Human Osteosarcoma Cells
Apoptosis And Anti-tumor Effect Induced By Mtor Inhibitor And Autophagy Inhibitor In Human Osteosarcoma Cells Ryosuke Horie. Kagawa University of medecine, Kita-gun, Japan. Disclosures: R. Horie: None.
More informationSupplementary Material - Methods
Novel Protein-Protein Interactions in the Schizophrenia interactome Supplementary Material - Methods Experimental validations of predicted interactions Table S1-1: Protein pairs that were validated by
More informationAttenuation of synaptic toxicity and MARK4/PAR1-mediated Tau phosphorylation by
Supplementary Methods and Figures Attenuation of synaptic toxicity and MARK4/PAR1-mediated Tau phosphorylation by methylene blue for Alzheimer s disease treatment Wenchao Sun 1, Seongsoo Lee 1,2, Xiaoran
More informationSUPPLEMENTARY MATERIALS AND METHODS
SUPPLEMENTARY MATERIALS AND METHODS Chemicals. All chemicals used in supplementary experiments were the same as in the manuscript except the following. Methyl-methanesulfonate (MMS) was from Fluka. NU1025
More informationSupplementary methods Shoc2 In Vitro Ubiquitination Assay
Supplementary methods Shoc2 In Vitro Ubiquitination Assay 35 S-labelled Shoc2 was prepared using a TNT quick Coupled transcription/ translation System (Promega) as recommended by manufacturer. For the
More informationThis is the author's accepted version of the manuscript.
This is the author's accepted version of the manuscript. The definitive version is published in Nature Communications Online Edition: 2015/4/16 (Japan time), doi:10.1038/ncomms7780. The final version published
More informationWestern Blot Tool Box
Western Blot Tool Box BOX12/BOX12-03 V1.1 Store at 2-8 C For research use only Introduction The Western Blot Tool Box is designed to conveniently provide reagents/buffers needed for Western blotting, from
More informationSUPPLEMENTAL MATERIAL. Supplemental Methods:
SUPPLEMENTAL MATERIAL Supplemental Methods: Immunoprecipitation- As we described but with some modifications [22]. As part of another ongoing project, lysate from human umbilical vein endothelial cells
More informationSupplementary Information: Materials and Methods. GST and GST-p53 were purified according to standard protocol after
Supplementary Information: Materials and Methods Recombinant protein expression and in vitro kinase assay. GST and GST-p53 were purified according to standard protocol after induction with.5mm IPTG for
More informationSUPPLEMENTAL MATERIALS SIRTUIN 1 PROMOTES HYPEROXIA-INDUCED LUNG EPITHELIAL DEATH INDEPENDENT OF NRF2 ACTIVATION
SUPPLEMENTAL MATERIALS SIRTUIN PROMOTES HYPEROXIA-INDUCED LUNG EPITHELIAL DEATH INDEPENDENT OF NRF ACTIVATION Haranatha R. Potteti*, Subbiah Rajasekaran*, Senthilkumar B. Rajamohan*, Chandramohan R. Tamatam,
More informationhours after food deprivation hours after food deprivation
Figure S.6 protein (fasted / control).2.8.4 p47 p97 Rpt Ufd 3 24 48 hours after food deprivation mrn (fasted / control) C mrn (denervated / control) 2.5 2.5.5 3.5 3 2.5 2.5.5 p97 ** Npl4 Ufd p47 2 3 4
More informationDDA3 associates with microtubule plus ends and orchestrates microtubule dynamics and directional cell migration
DDA3 associates with microtubule plus ends and orchestrates microtubule dynamics and directional cell migration Liangyu Zhang 1,2,4, Hengyi Shao 1,4, Tongge Zhu, Peng Xia 1, Zhikai Wang 1,2, Lifang Liu
More informationab G alpha i Activation Assay Kit
ab173234 G alpha i Activation Assay Kit Instructions for Use For the simple and fast measurement of G alpha i activation. This product is for research use only and is not intended for diagnostic use. Version
More informationSupplementary Information
Journal : Nature Biotechnology Supplementary Information Targeted genome engineering in human cells with RNA-guided endonucleases Seung Woo Cho, Sojung Kim, Jong Min Kim, and Jin-Soo Kim* National Creative
More informationAnti-p62 C-terminal pab
Page 1 For Research Use Only. Not for use in diagnostic procedures. Anti-p62 C-terminal pab CODE No. CLONALITY Polyclonal ISOTYPE Guinea pig Ig, affinity purified QUANTITY 100 µl SOURCE IMMUNOGEN FORMURATION
More informationGene Forward Primer Reverse Primer GAPDH ATCATCCCTGCCTCTACTGG GTCAGGTCCACCACTGACAC SSB1 AACTTCAGTGAGCCAAACCC GTTCTCAGAGGCTGGAGAGG
Supplemental Data EXPERIMENTAL PROCEDURES Plasmids and Antibodies- Full length cdna of INT11 or INT12 were cloned into ps- Flag-SBP vector respectively. Anti-RNA pol II (RPB1) was purchased from Santa
More informationOnline Supplementary Information
Online Supplementary Information NLRP4 negatively regulates type I interferon signaling by targeting TBK1 for degradation via E3 ubiquitin ligase DTX4 Jun Cui 1,4,6,7, Yinyin Li 1,5,6,7, Liang Zhu 1, Dan
More informationSupplemental Table 1: Sequences of real time PCR primers. Primers were intronspanning
Symbol Accession Number Sense-primer (5-3 ) Antisense-primer (5-3 ) T a C ACTB NM_001101.3 CCAGAGGCGTACAGGGATAG CCAACCGCGAGAAGATGA 57 HSD3B2 NM_000198.3 CTTGGACAAGGCCTTCAGAC TCAAGTACAGTCAGCTTGGTCCT 60
More informationSupporting Online Material
Supporting Online Material 1. Materials and Methods 2. Supporting online figures 3. Supporting online references 1. Material and Methods Plasmid constructs All AvrPphB and protease inactive AvrPphB() constructs
More informationPhos-tag beads as an immunoblotting enhancer for selective detection of phosphoproteins in cell lysates
Notes & Tips Phos-tag beads as an immunoblotting enhancer for selective detection of phosphoproteins in cell lysates Emiko Kinoshita-Kikuta, Eiji Kinoshita *, and Tohru Koike Department of Functional Molecular
More informationSupplemental Information. PARP1 Represses PAP and Inhibits Polyadenylation during Heat Shock
Molecular Cell, Volume 49 Supplemental Information PARP1 Represses PAP and Inhibits Polyadenylation during Heat Shock Dafne Campigli Di Giammartino, Yongsheng Shi, and James L. Manley Supplemental Information
More informationThe E3 ligase Itch and deubiquitinase Cyld co-operatively regulate Tak1 and inflammation
The E3 ligase Itch and deubiquitinase Cyld co-operatively regulate Tak1 and inflammation Neesar Ahmed 1, Minghui Zeng 1, Indrajit Sinha 1, Lisa Polin 1, Wei-Zen Wei 1, Chozhavendan Rathinam 2, Richard
More informationFig. S1 TGF RI inhibitor SB effectively blocks phosphorylation of Smad2 induced by TGF. FET cells were treated with TGF in the presence of
Fig. S1 TGF RI inhibitor SB525334 effectively blocks phosphorylation of Smad2 induced by TGF. FET cells were treated with TGF in the presence of different concentrations of SB525334. Cells were lysed and
More informationHPV E6 oncoprotein targets histone methyltransferases for modulating specific. Chih-Hung Hsu, Kai-Lin Peng, Hua-Ci Jhang, Chia-Hui Lin, Shwu-Yuan Wu,
1 HPV E oncoprotein targets histone methyltransferases for modulating specific gene transcription 3 5 Chih-Hung Hsu, Kai-Lin Peng, Hua-Ci Jhang, Chia-Hui Lin, Shwu-Yuan Wu, Cheng-Ming Chiang, Sheng-Chung
More informationSUPPLEMENTAL MATERIAL. Supplemental Methods. Cumate solution was from System Biosciences. Human complement C1q and complement
SUPPLEMENTAL MATERIAL Supplemental Methods Reagents Cumate solution was from System Biosciences. Human complement Cq and complement C-esterase inhibitor (C-INH) were from Calbiochem. C-INH (Berinert) for
More informationSupplementary Fig. 1 Identification of Nedd4 as an IRS-2-associated protein in camp-treated FRTL-5 cells.
Supplementary Fig. 1 Supplementary Fig. 1 Identification of Nedd4 as an IRS-2-associated protein in camp-treated FRTL-5 cells. (a) FRTL-5 cells were treated with 1 mm dibutyryl camp for 24 h, and the lysates
More informationab Ran Activation Assay Kit
ab173247 Ran Activation Assay Kit Instructions for Use For the simple and fast measurement of Ran activation. This product is for research use only and is not intended for diagnostic use. Version 1 Last
More information