Notch1 (forward: 5 -TGCCTGTGCACACCATTCTGC-3, reverse: Notch2 (forward: 5 -ATGCACCATGACATCGTTCG-3, reverse:
|
|
|
- Shanon Elizabeth Nelson
- 5 years ago
- Views:
Transcription
1 Supplementary Information Supplementary Methods. RT-PCR. For mouse ES cells, the primers used were: Notch1 (forward: 5 -TGCCTGTGCACACCATTCTGC-3, reverse: 5 -CAATCAGAGATGTTGGAATGC-3 ) 1, Notch2 (forward: 5 -ATGCACCATGACATCGTTCG-3, reverse: 5 -GATAGAGTCACTGAGCTCTCG-3 ) 1, Notch3 (forward: 5 -TTGGTCTGCTCAATCCTGTAGC-3, reverse: 5 -TGGCATTGGTAGCAGTTGCTG-3 ) 1, Notch4 (forward: 5 -AAGCGACACGTACGAGTCTGG-3, reverse: 5 -ATAGTTGCCAGCTACTTGTGG-3 ) 1, Hes1 (forward: 5 -TCTACACCAGCAACAGTGG-3, reverse: 5 -TCAAACATCTTTGGCATCAC-3 ) 1, Hes5 (forward: 5 -AAGTGACTTCTGCGAAGTTCC-3, reverse: 5 -AAGGCCATGTGGACCTTGAGG-3 ) 1, Hey1 (forward: 5 -TCGAGAAGCGCCGACGAGACCGA-3, reverse: 5 -CAGCAGAGGGTGTGCGATGTGTGGGT-3 ) 2, gnat1 (forward: 5 -GAGCTTAACATGCGACGTGA-3, reverse: 5 -GCTGCTGTAGGTCCAAGAGG-3 ), pde6b (forward: 5 -CATGAATGGCAAAGATGTCG-3, reverse: 5 -GTGTTCGTGGGCCTGAGTAT-3 ), pde6c (forward: 5 -GAGGTCCTTGCTGTGGTCAT-3, reverse: 5 -CCTTGTGAAACTGTCGCTCA-3 ), cnga1 (forward: 5 -GAGCAAGGCCGATGATAAAA-3, reverse:
2 5 -TCACTAGCAGCCCTTGTTCC-3 ), sag (forward: 5 -GTCCTCACCCAACTCCAAGA-3, reverse: 5 -GTTGTTGGTCACGGTCACAG-3 ), arr3 (forward: 5 -GTCCTTGTTGACCCCGAGTA-3, reverse: 5 -CTGCACTTTCCGTACAACCA-3 ), grk1 (forward: 5 -CTGCATCAGAGACGCATTGT-3, reverse: 5 -TCTCCAACAGCTGCTCACAG-3 ) pdc (forward: 5 - CACACAGGACCCAAAGGAGT-3, reverse: 5 -TCTGCTCCTTCTCGATGGTT-3 ), rdh12 (forward: 5 -GGCCAATCTGCTCTTCACTC-3, reverse: 5 -TGAAAAGGCTCTGGTCTTCG-3 ) rbp3 (forward: 5 -TTCCCTCCCCAGAAGTCTTT-3, reverse: 5 -GGATGGCTACGCTCTTCTTG-3 ), rp1h (forward: 5 -CGAAGCCTTTCTGCAGTACC-3, reverse: 5 -AGGGAATCAGTCTGGGGTCT-3 ), rpgrip1 (forward: 5 -CAGACTACCGACAGCGATGA-3, reverse: 5 -TTGGTTTCCTCAGGGACATC-3 ). For human ES cells, the primers used were as follows: transducin alpha1 (Guanine nucleotide-binding protein alpha 1 subunit (GNAT1)) (forward: 5 -CATCGAGACGCAGTTCTCCT-3, reverse: 5 -AGTAGCGGTGGTTGCAGATG-3 ), phosducin (PDC) (forward: 5 -TCAAAGGAACGAGTCAGCAG-3, reverse: 5 -CTGCTGCAAGGCATGTTAAA-3 ), phosphodiesterase 6b (PDE6b) (forward: 5 -CAGTGATGAACACCGACACC-3,
3 reverse: 5 -ATTTGACCAGGTCCAGTTCG-3 ), PDE6c (forward: 5 -CTGAGGTGGCCTCTAGGTTG-3, reverse: 5 -GCTGGTGTGATGAAGCCTTAG-3 ), cgmp-gated channel alpha1 (CNGA1) (forward: 5 -GATCCCTCGGGAAACACATA-3, reverse: 5 -CGAGAGAACCGTAACAACCTGG-3 ), rhodopsin kinase (GRK1) (forward: 5 -GGACTGGTTCCTGGACTTCA-3, reverse: 5 -AAGCCAGGGTTCTCCTCATT-3 ), arrestin (S-antigen, SAG) (forward: 5 -GGTGTTGTCCTGGTTGATCC-3, reverse: 5 -TCAGCGTCTTGGTCAAAGTG-3 ), arrestin3 (ARR3) (forward: 5 -GGTGTTGTCCTGGTTGATCC-3, reverse: 5 -GTCACAGAACAGGGCAGGTT-3 ), retinol dehydrogenase 12 (RDH12) (forward: 5 -CTTCTCCCCCTTTGTCAAGA-3, reverse: 5 -CTTTAGGGTTGGCCTTCTCC-3 ), glyceraldehyde-3-phosphate dehydrogenase (GAPDH) (forward: 5 -GCCTCTAGGTTGCTGGATGT-3, reverse: 5 -GCTGGTGTGATGAAGCCTTAG-3 ). References 1. Kaneta, M. et al. A role for Pref-1 and HES-1 in thymocyte development. J. Immunol. 164, (2000). 2. Chen, L. & Al-Awqati, Q. Segmental expression of Notch and Hairy genes in nephrogenesis. Am. J. Physiol. Renal Physiol. 288, F939-F952 (2005).
4 Supplementary Figure 1. ES-derived neural retinal progenitors were properly marked with fluorescence. (a-e) Immunostaining of SFEB/DLFA-treated Rx-GFP knocked-in ES cells on day 8. Rx+ cells (red, a) co-expressed GFP (green, b) and Pax6 (blue, c). Rx and GFP (d), and Rx and Pax6 (e) expression. Merged images of Scale bar, 20 µm. For anti-rx antibody production, cdna encoding an N-terminal portion of mouse Rx (residues ; mrx-n) were amplified with PCR, and subcloned into pgex-4t-3 (Amersham Biosciences). The fusion proteins were expressed in E. coli strain BL21 and purified with glutathione sepharose 4B (Amersham Biosciences) according to manufacturer s instructions. The rabbit antisera against mrx-n were obtained by immunizing rabbits with the purified GST-mRx-N, preadsorbed with GST-Sepharose, and affinity purified with the immunizing fusion protein bounded-sepharose column (Kitayama Labes).
5 Supplementary Figure 2. The γ-secretase inhibitor DAPT promotes the development of photoreceptor precursors by inhibiting Notch signaling. (a,b) After 2 days, the retinae were stained for Crx and TOTO-3. Retinae of E17.5 mice were treated with or without DAPT (10 µm) for 2-4 days under organ culture. Many Crx+ (green) photoreceptor precursors were seen in the DAPT-treated retina (a), while several Crx+ cells were seen in the untreated retina (b). GC: ganglion cell layer, NBL: neuroblastic layer, ONL: outer nuclear layer. (c) RT-PCR analysis of the retina treated with or without DAPT for 2 or 4 days. The Hes1 and Hes5 expressions were confirmed to decrease in the DAPT-treated retina.
6 Supplementary Figure 3. DAPT promotes the differentiation of FACS-purified retinal progenitors into Crx+ photoreceptor precursors. (a,b) The effect of DAPT treatment on the differentiation of FACS-purified ES-derived cells into Crx+ cells. (a) Culture scheme for the experiment. (b) The percentage of Crx+ aggregates in cells treated with or without DAPT (10 µm) on day 20. (c) Percentage of Crx+ cells in the FACS-purified cells treated with DAPT from day 10 on days 16, 18 and 20 (*P < 0.05, ***P < 0.001, Tukey s test).
7 Supplementary Figure 4. DAPT treatment decreased the number of mitotic cells. (a-c) Crx+ cells were negative for Ki67 (a), BrdU (2h uptake) (b), and PCNA (c). (d,e) The sorted cells were treated with (triangles) or without (circles) DAPT and the percentage of Ki67+ (d) and BrdU+ (after 24h uptake) (e) cells on each differentiation day was determined. ***P < 0.001, Bonferroni test. (f) No difference was seen between the percentage of active caspase 3+ cells in the Ki67+ populations of the DAPT-treated and untreated cells on each differentiation day (NS, not significant, Bonferroni test). Scale bar, 20 µm.
8 Supplementary Figure 5. Differentiation of monkey ES cells into retinal cells. SFEB/DL treatment induces HPC-1+/Pax6+ amacrine cells (a), PKC+ bipolar cells (b) and Islet1/2+/Pax6+ ganglion cells (c) in monkey ES cultures.
9 Supplementary Figure 6. Ex vivo transplantation of mouse ES cell-derived retinal cells into the mouse retina. (a,b) Mouse ES cells were treated with SFEB/DLFA, purified with FACS and then treated with DAPT and retinoic acid/taurine/shh/afgf/bfgf. These cells were labeled FITC-labeling reagent and transplanted into the P8 mouse retina ex vivo. FITC+ cells present in the ONL expressed the photoreceptor marker rhodopsin (arrowhead), indicating that mouse ES cell-derived rhodopsin+ photoreceptors have the ability to integrate into the proper location of the retina. ONL: outer nuclear layer.
Supplementary Fig. S1. Schematic representation of mouse lines Pax6 fl/fl and mrx-cre used in this study. (A) To generate Pax6 fl/ fl
Supplementary Fig. S1. Schematic representation of mouse lines Pax6 fl/fl and mrx-cre used in this study. (A) To generate Pax6 fl/ fl, loxp sites flanking exons 3-6 (red arrowheads) were introduced into
Positive selection gates for the collection of LRCs or nonlrcs had to be drawn based on the location and
Determining positive selection gates for LRCs and nonlrcs Positive selection gates for the collection of LRCs or nonlrcs had to be drawn based on the location and shape of the Gaussian distributions. For
Supplementary Fig. 5
Supplementary Fig. 5 Supplemental Figures legends Supplementary Figure 1 (A) Additional dot plots from CyTOF analysis from untreated group. (B) Gating strategy for assessment of CD11c + NK cells frequency
Figure S1 is related to Figure 1B, showing more details of outer segment of
Supplemental Information Supplementary Figure legends and Figures Figure S1. Electron microscopic images in Sema4A +/+ and Sema4A / retinas Figure S1 is related to Figure 1B, showing more details of outer
Supplementary Methods
Supplementary Methods Reverse transcribed Quantitative PCR. Total RNA was isolated from bone marrow derived macrophages using RNeasy Mini Kit (Qiagen), DNase-treated (Promega RQ1), and reverse transcribed
SUPPLEMENTARY FIGURES
SUPPLEMENTARY FIGURES Supplementary Figure S1. Generation of a synaptobrevin2-mrfp knock-in mouse. (a) Targeting strategy of Syb2-mRFP knock-in mouse leaving the synaptobrevin2 gene locus intact except
Supporting Online Material for
www.sciencemag.org/cgi/content/full/323/5911/256/dc1 Supporting Online Material for HDAC4 Regulates Neuronal Survival in Normal and Diseased Retinas Bo Chen and Constance L. Cepko E-mail: bochen@genetics.med.harvard.edu,
Supplementary Figure 1. Retinogenesis during human embryonic development and in 3-D retinal cups (RCs) derived from hipsc. a, Main steps leading to
Supplementary Figure 1. Retinogenesis during human embryonic development and in 3-D retinal cups (RCs) derived from hipsc. a, Main steps leading to the formation of the human retina in vivo. b, Diagram
Supplementary Figures
Supplementary Figures Fig. S1. Specificity of perilipin antibody in SAT compared to various organs. (A) Images of SAT at E18.5 stained with perilipin and CD31 antibody. Scale bars: 100 μm. SAT stained
Supplemental material
Supplemental material THE JOURNAL OF CELL BIOLOGY Taylor et al., http://www.jcb.org/cgi/content/full/jcb.201403021/dc1 Figure S1. Representative images of Cav 1a -YFP mutants with and without LMB treatment.
Identification and characterization of early photoreceptor cis-regulatory elements and their relation to Onecut1
Jean-Charles et al. Neural Development (2018) 13:26 https://doi.org/10.1186/s13064-018-0121-x RESEARCH ARTICLE Identification and characterization of early photoreceptor cis-regulatory elements and their
Supplementary Figure 1. Expressions of stem cell markers decreased in TRCs on 2D plastic. TRCs were cultured on plastic for 1, 3, 5, or 7 days,
Supplementary Figure 1. Expressions of stem cell markers decreased in TRCs on 2D plastic. TRCs were cultured on plastic for 1, 3, 5, or 7 days, respectively, and their mrnas were quantified by real time
Supplementary Figure 1.
Supplementary Figure 1. (A) UCSC Genome Browser view of region immediately downstream of the NEUROG3 start codon. All candidate grna target sites which meet the G(N 19 )NGG constraint are aligned to illustrate
Flow cytometry Stained cells were analyzed and sorted by SORP FACS Aria (BD Biosciences).
Mice C57BL/6-Ly5.1 or -Ly5.2 congenic mice were used for LSK transduction and competitive repopulation assays. Animal care was in accordance with the guidelines of Keio University for animal and recombinant
Stargazin regulates AMPA receptor trafficking through adaptor protein. complexes during long term depression
Supplementary Information Stargazin regulates AMPA receptor trafficking through adaptor protein complexes during long term depression Shinji Matsuda, Wataru Kakegawa, Timotheus Budisantoso, Toshihiro Nomura,
Table S1. Antibodies and recombinant proteins used in this study
Table S1. Antibodies and recombinant proteins used in this study Labeled Antibody Clone Cat. no. Streptavidin-PerCP BD Biosciences 554064 Biotin anti-mouse CD25 7D4 BD Biosciences 553070 PE anti-mouse
Figure S1 Proteasome inhibition leads to formation of aggregates in human cells and tissues. (a)
SUPPLEMENTARY MATERIAL Figure S1 Proteasome inhibition leads to formation of aggregates in human cells and tissues. (a) Flow cytometry. Cells were treated with MG132 for the indicated times. Cells were
(a) Scheme depicting the strategy used to generate the ko and conditional alleles. (b) RT-PCR for
Supplementary Figure 1 Generation of Diaph3 ko mice. (a) Scheme depicting the strategy used to generate the ko and conditional alleles. (b) RT-PCR for different regions of Diaph3 mrna from WT, heterozygote
At E17.5, the embryos were rinsed in phosphate-buffered saline (PBS) and immersed in
Supplementary Materials and Methods Barrier function assays At E17.5, the embryos were rinsed in phosphate-buffered saline (PBS) and immersed in acidic X-gal mix (100 mm phosphate buffer at ph4.3, 3 mm
Supplemental Figure 1 HDA18 has an HDAC domain and therefore has concentration dependent and TSA inhibited histone deacetylase activity.
Supplemental Figure 1 HDA18 has an HDAC domain and therefore has concentration dependent and TSA inhibited histone deacetylase activity. (A) Amino acid alignment of HDA5, HDA15 and HDA18. The blue line
SUPPLEMENTARY INFORMATION
doi:10.1038/nature09941 Supplementary Figures and legends Supplementary Fig. 1 Eye-cup formation in vivo and in ESC culture. a, Schematic of in vivo retinal development. b, SFEBq culture for retinal induction.
Supplementary Figure 1. Soft fibrin gels promote growth and organized mesodermal differentiation. Representative images of single OGTR1 ESCs cultured
Supplementary Figure 1. Soft fibrin gels promote growth and organized mesodermal differentiation. Representative images of single OGTR1 ESCs cultured in 90-Pa 3D fibrin gels for 5 days in the presence
SUPPLEMENTARY INFORMATION
a before amputation regeneration regenerated limb DERMIS SKELETON MUSCLE SCHWANN CELLS EPIDERMIS DERMIS SKELETON MUSCLE SCHWANN CELLS EPIDERMIS developmental origin: lateral plate mesoderm presomitic mesoderm
Int. J. Mol. Sci. 2016, 17, 1259; doi: /ijms
S1 of S5 Supplementary Materials: Fibroblast-Derived Extracellular Matrix Induces Chondrogenic Differentiation in Human Adipose-Derived Mesenchymal Stromal/Stem Cells in Vitro Kevin Dzobo, Taegyn Turnley,
7-amino actinomycin D (7ADD) was added to all samples 10 minutes prior to analysis on the flow cytometer in order to gate 7AAD viable cells.
Antibody staining for Ho uptake analyses For HSC staining, 10 7 BM cells from Ho perfused mice were stained with biotinylated lineage antibodies (CD3, CD5, B220, CD11b, Gr-1, CD41, Ter119), anti Sca-1-PECY7,
supplementary information
DOI: 10.1038/ncb2015 Figure S1 Confirmation of Sca-1 CD34 stain specificity using isotypematched control antibodies. Skeletal muscle preparations were stained and gated as described in the text (Hoechst
Supplementary Figure 1. Nature Structural & Molecular Biology: doi: /nsmb.3494
Supplementary Figure 1 Pol structure-function analysis (a) Inactivating polymerase and helicase mutations do not alter the stability of Pol. Flag epitopes were introduced using CRISPR/Cas9 gene targeting
Supplementary Information. A novel human endogenous retroviral protein inhibits cell-cell fusion. Supplementary Figures:
Supplementary Information A novel human endogenous retroviral protein inhibits cell-cell fusion Jun Sugimoto, Makiko Sugimoto, Helene Bernstein, Yoshihiro Jinno and Danny J. Schust Supplementary Figures:
Supplementary Figure S1. N-terminal fragments of LRRK1 bind to Grb2.
Myc- HA-Grb2 Mr(K) 105 IP HA 75 25 105 1-1163 1-595 - + - + - + 1164-1989 Blot Myc HA total lysate 75 25 Myc HA Supplementary Figure S1. N-terminal fragments of bind to Grb2. COS7 cells were cotransfected
Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table.
Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table. Name Sequence (5-3 ) Application Flag-u ggactacaaggacgacgatgac Shared upstream primer for all the amplifications of
Supplementary Figure 1: Derivation and characterization of RN ips cell lines. (a) RN ips cells maintain expression of pluripotency markers OCT4 and
Supplementary Figure 1: Derivation and characterization of RN ips cell lines. (a) RN ips cells maintain expression of pluripotency markers OCT4 and SSEA4 after 10 passages in mtesr 1 medium. (b) Schematic
Supplementary Materials for
www.sciencesignaling.org/cgi/content/full/3/146/ra80/dc1 Supplementary Materials for DNMT1 Stability Is Regulated by Proteins Coordinating Deubiquitination and Acetylation-Driven Ubiquitination Zhanwen
(a) Immunoblotting to show the migration position of Flag-tagged MAVS
Supplementary Figure 1 Characterization of six MAVS isoforms. (a) Immunoblotting to show the migration position of Flag-tagged MAVS isoforms. HEK293T Mavs -/- cells were transfected with constructs expressing
immunofluorescence. Name of antibodies Manufacturer Catalog Number Rabbit anti-pdyn Rabbit anti-kor-1
Supplemental Tables Table S1. List of primary antibodies used for immunohistochemistry, FACS, and immunofluorescence. Name of antibodies Manufacturer Catalog Number Rabbit anti-pdyn Bioss USA bs-13041r
Supplemental Data. LMO4 Controls the Balance between Excitatory. and Inhibitory Spinal V2 Interneurons
Neuron, Volume 61 Supplemental Data LMO4 Controls the Balance between Excitatory and Inhibitory Spinal V2 Interneurons Kaumudi Joshi, Seunghee Lee, Bora Lee, Jae W. Lee, and Soo-Kyung Lee Supplemental
SUPPLEMENTARY INFORMATION
R2A MASNSEKNPLL-SDEKPKSTEENKSS-KPESASGSSTSSAMP---GLNFNAFDFSNMASIL 56 R2B MASSSEKTPLIPSDEKNDTKEESKSTTKPESGSGAPPSPS-PTDPGLDFNAFDFSGMAGIL 60 R2A NDPSIREMAEQIAKDPAFNQLAEQLQRSIPNAGQEGGFPNFDPQQYVNTMQQVMHNPEFK
Mammosphere formation assay. Mammosphere culture was performed as previously described (13,
Supplemental Text Materials and Methods Mammosphere formation assay. Mammosphere culture was performed as previously described (13, 17). For co-culture with fibroblasts and treatment with CM or CCL2, fibroblasts
Supplementary Table-1: List of genes that were identically matched between the ST2 and
Supplementary data Supplementary Table-1: List of genes that were identically matched between the ST2 and ST3. Supplementary Table-2: List of genes that were differentially expressed in GD2 + cells compared
Supplementary Figure 1. Homozygous rag2 E450fs mutants are healthy and viable similar to wild-type and heterozygous siblings.
Supplementary Figure 1 Homozygous rag2 E450fs mutants are healthy and viable similar to wild-type and heterozygous siblings. (left) Representative bright-field images of wild type (wt), heterozygous (het)
Supplementary Figure 1: Analysis of monocyte subsets and lineage relationships. (a) Gating strategy for definition of MDP and cmop populations in BM
Supplementary Figure 1: Analysis of monocyte subsets and lineage relationships. (a) Gating strategy for definition of MDP and cmop populations in BM of Cx3cr1 GFP/+ mice related to Fig. 1a. MDP was defined
A population of Nestin expressing progenitors in the cerebellum exhibits increased tumorigenicity
A population of Nestin expressing progenitors in the cerebellum exhibits increased tumorigenicity Peng Li 1,2, Fang Du 1, Larra W. Yuelling 1, Tiffany Lin 3, Renata E. Muradimova 1, Rossella Tricarico
Supplementary Information: Materials and Methods. GST and GST-p53 were purified according to standard protocol after
Supplementary Information: Materials and Methods Recombinant protein expression and in vitro kinase assay. GST and GST-p53 were purified according to standard protocol after induction with.5mm IPTG for
SUPPLEMENTAL FIGURES AND TABLES
SUPPLEMENTAL FIGURES AND TABLES A B Flag-ALDH1A1 IP: α-ac HEK293T WT 91R 128R 252Q 367R 41/ 419R 435R 495R 412R C Flag-ALDH1A1 NAM IP: HEK293T + + - + D NAM - + + E Relative ALDH1A1 activity 1..8.6.4.2
Supplementary Figure 1. Isolation of GFPHigh cells.
Supplementary Figure 1. Isolation of GFP High cells. (A) Schematic diagram of cell isolation based on Wnt signaling activity. Colorectal cancer (CRC) cell lines were stably transduced with lentivirus encoding
Supplementary Information
Supplementary Information Supplementary Figure 1: Identification of new regulators of MuSC by a proteome-based shrna screen. (a) FACS plots of GFP + and GFP - cells from Pax7 ICN -Z/EG (upper panel) and
Fig. S1. Effect of p120-catenin overexpression on the interaction of SCUBE2 with E-cadherin. The expression plasmid encoding FLAG.
Fig. S1. Effect of p120-catenin overexpression on the interaction of SCUBE2 with E-cadherin. The expression plasmid encoding FLAG.SCUBE2, E-cadherin.Myc, or HA.p120-catenin was transfected in a combination
Supplementary Figure S1. Expression of complement components in E4 chick eyes. (a) A
Supplementary Figure S1. Expression of complement components in E4 chick eyes. (a) A schematic of the eye showing the ciliary margin (CM) of the anterior region, and the neuroepithelium (NE) and retinal
Nature Biotechnology: doi: /nbt.4166
Supplementary Figure 1 Validation of correct targeting at targeted locus. (a) by immunofluorescence staining of 2C-HR-CRISPR microinjected embryos cultured to the blastocyst stage. Embryos were stained
hnrnp D/AUF1 Rabbit IgG hnrnp M
Mouse IgG Goat IgG Rabbit IgG Mouse IgG hnrnp F Goat IgG Mouse IgG Kb 6 4 3 2 15 5 Supplementary Figure S1. In vivo binding of TERRA-bound RBPs to target RNAs. Immunoprecipitation (IP) assay using 3 mg
Supplementary information
Supplementary information The E3 ligase RNF8 regulates KU80 removal and NHEJ repair Lin Feng 1, Junjie Chen 1 1 Department of Experimental Radiation Oncology, The University of Texas M. D. Anderson Cancer
pgbkt7 Anti- Myc AH109 strain (KDa) 50
pgbkt7 (KDa) 50 37 Anti- Myc AH109 strain Supplementary Figure 1. Protein expression of CRN and TDR in yeast. To analyse the protein expression of CRNKD and TDRKD, total proteins extracted from yeast culture
File name: Supplementary Information Description: Supplementary figures and supplementary tables. File name: Peer review file Description:
File name: Supplementary Information Description: Supplementary figures and supplementary tables. File name: Peer review file Description: Supplementary Figure 1. dcas9-mq1 fusion protein induces de novo
Supplemental Information Inventory
Cell Stem Cell, Volume 6 Supplemental Information Distinct Hematopoietic Stem Cell Subtypes Are Differentially Regulated by TGF-β1 Grant A. Challen, Nathan C. Boles, Stuart M. Chambers, and Margaret A.
Allele-specific locus binding and genome editing by CRISPR at the
Supplementary Information Allele-specific locus binding and genome editing by CRISPR at the p6ink4a locus Toshitsugu Fujita, Miyuki Yuno, and Hodaka Fujii Supplementary Figure Legends Supplementary Figure
supplementary information
Figure S1 Distribution of heterokaryons in vermis and hemispheres of the cerebellum. Schematic dorsal view of an adult cerebellum with the vermis in the middle (red) flanked by the two hemispheres (grey).
0.9 5 H M L E R -C tr l in T w is t1 C M
a. b. c. d. e. f. g. h. 2.5 C elltiter-g lo A ssay 1.1 5 M T S a s s a y Lum inescence (A.U.) 2.0 1.5 1.0 0.5 n s H M L E R -C tr l in C tr l C M H M L E R -C tr l in S n a il1 C M A bsorbance (@ 490nm
Sarker et al. Supplementary Material. Subcellular Fractionation
Supplementary Material Subcellular Fractionation Transfected 293T cells were harvested with phosphate buffered saline (PBS) and centrifuged at 2000 rpm (500g) for 3 min. The pellet was washed, re-centrifuged
Figure legends for supplement
Figure legends for supplement Supplemental Figure 1 Characterization of purified and recombinant proteins Relevant fractions related the final stage of the purification protocol(bingham et al., 1998; Toba
Nature Biotechnology: doi: /nbt Supplementary Figure 1. Generation of NSCs from hpscs in SDC medium.
Supplementary Figure 1 Generation of NSCs from hpscs in SDC medium. (a) Q-PCR of pluripotent markers (OCT4, NANOG), neural markers (SOX1, PAX6, N-Cadherin), markers for the other germ layers (T, EOMES,
Spironolactone ameliorates PIT1-dependent vascular osteoinduction in klotho-hypomorphic mice
Spironolactone ameliorates PIT1-dependent vascular osteoinduction in klotho-hypomorphic mice Supplementary Material Supplementary Methods Materials Spironolactone, aldosterone and β-glycerophosphate were
Reprogramming Müller glia via in vivo cell fusion regenerates murine photoreceptors
Reprogramming Müller glia via in vivo cell fusion regenerates murine photoreceptors Daniela Sanges,, Marta Nicolás, Maria Pia Cosma J Clin Invest. 2016;126(8):3104-3116. https://doi.org/10.1172/jci85193.
Supplementary Fig. 1. Schematic structure of TRAIP and RAP80. The prey line below TRAIP indicates bait and the two lines above RAP80 highlight the
Supplementary Fig. 1. Schematic structure of TRAIP and RAP80. The prey line below TRAIP indicates bait and the two lines above RAP80 highlight the prey clones identified in the yeast two hybrid screen.
Supplementary information. Supplementary Figures
Supplementary information Supplementary Figures Supplementary Figure 1. A. i. HA-JMY expressing U2OS cells were treated with SAHA (6h). DAPI was used to visualise nuclei. ii. U2OS cells stably expressing
Development 142: doi: /dev : Supplementary Material
Development 142: doi:1.42/dev.11687: Supplementary Material Figure S1 - Relative expression of lineage markers in single ES cell and cardiomyocyte by real-time quantitative PCR analysis. Single ES cell
Post-translational modification
Protein expression Western blotting, is a widely used and accepted technique to detect levels of protein expression in a cell or tissue extract. This technique measures protein levels in a biological sample
SUPPLEMENTARY INFORMATION
doi:10.1038/nature11070 Supplementary Figure 1 Purification of FLAG-tagged proteins. a, Purification of FLAG-RNF12 by FLAG-affinity from nuclear extracts of wild-type (WT) and two FLAG- RNF12 transgenic
Supplemental Table 1 Primers used in study. Human. Mouse
Supplemental Table 1 Primers used in study Human Forward primer region(5-3 ) Reverse primer region(5-3 ) RT-PCR GAPDH gagtcaacggatttggtcgt ttgattttggagggatctcg Raftlin atgggttgcggattgaacaagttaga ctgaggtataacaccaacgaatttcaggc
Supplementary Information: Materials and Methods. Immunoblot and immunoprecipitation. Cells were washed in phosphate buffered
Supplementary Information: Materials and Methods Immunoblot and immunoprecipitation. Cells were washed in phosphate buffered saline (PBS) and lysed in TNN lysis buffer (50mM Tris at ph 8.0, 120mM NaCl
Supplementary Figure 1. APP cleavage assay. HEK293 cells were transfected with various
Supplementary Figure 1. APP cleavage assay. HEK293 cells were transfected with various GST-tagged N-terminal truncated APP fragments including GST-APP full-length (FL), APP (123-695), APP (189-695), or
Supplementary Table, Figures and Videos
Supplementary Table, Figures and Videos Table S1. Oligonucleotides used for different approaches. (A) RT-qPCR study. (B) qpcr study after ChIP assay. (C) Probes used for EMSA. Figure S1. Notch activation
Nature Immunology: doi: /ni Supplementary Figure 1
Supplementary Figure 1 BALB/c LYVE1-deficient mice exhibited reduced lymphatic trafficking of all DC subsets after oxazolone-induced sensitization. (a) Schematic overview of the mouse skin oxazolone contact
Supplementary Figure 1. GST pull-down analysis of the interaction of GST-cIAP1 (A, B), GSTcIAP1
Legends Supplementary Figure 1. GST pull-down analysis of the interaction of GST- (A, B), GST mutants (B) or GST- (C) with indicated proteins. A, B, Cell lysate from untransfected HeLa cells were loaded
SUPPLEMENTARY INFORMATION
doi:10.1038/nature22047 Supplementary discussion Overall developmental timeline and brain regionalization in human whole-brain organoids We first defined the timeline of generation of broadly-defined cell
all samples of a band with a molecular weight close to that expected for the endogenous!-
SUPPLEMENTAL FIGURE LEGENDS Supplemental Figure 1 : Specificity of anti-!-arrestin Abs and levels of!-arrestin in WHIM wt leukocytes. (A and B) HEK 293T cells were transiently transfected using the reagent
Supplementary Figure 1. α-synuclein is truncated in PD and LBD brains. Nature Structural & Molecular Biology: doi: /nsmb.
Supplementary Figure 1 α-synuclein is truncated in PD and LBD brains. (a) Specificity of anti-n103 antibody. Anti-N103 antibody was coated on an ELISA plate and different concentrations of full-length
GENESDEV/2007/ Supplementary Figure 1 Elkabetz et al.,
GENESDEV/2007/089581 Supplementary Figure 1 Elkabetz et al., GENESDEV/2007/089581 Supplementary Figure 2 Elkabetz et al., GENESDEV/2007/089581 Supplementary Figure 3 Elkabetz et al., GENESDEV/2007/089581
Mayumi Egawa, Kaori Mukai, Soichiro Yoshikawa, Misako Iki, Naofumi Mukaida, Yohei Kawano, Yoshiyuki Minegishi, and Hajime Karasuyama
Immunity, Volume 38 Supplemental Information Inflammatory Monocytes Recruited to Allergic Skin Acquire an Anti-inflammatory M2 Phenotype via Basophil-Derived Interleukin-4 Mayumi Egawa, Kaori Mukai, Soichiro
Rapid differentiation of human pluripotent stem cells into functional motor neurons by
Supplementary Information Rapid differentiation of human pluripotent stem cells into functional motor neurons by mrnas encoding transcription factors Sravan Kumar Goparaju, Kazuhisa Kohda, Keiji Ibata,
GFP CCD2 GFP IP:GFP
D1 D2 1 75 95 148 178 492 GFP CCD1 CCD2 CCD2 GFP D1 D2 GFP D1 D2 Beclin 1 IB:GFP IP:GFP Supplementary Figure 1: Mapping domains required for binding to HEK293T cells are transfected with EGFP-tagged mutant
MRC-Holland MLPA. Description version 05;
MLPA Probemix P235-B2 Retinitis Pigmentosa Lot B2-1013: As compared to the previous version B1 (lot B1-0808), two reference probes have been replaced and one added; in addition, the control fragments have
Supplementary Fig. 1. (A) Working model. The pluripotency transcription factor OCT4
SUPPLEMENTARY FIGURE LEGENDS Supplementary Fig. 1. (A) Working model. The pluripotency transcription factor OCT4 directly up-regulates the expression of NIPP1 and CCNF that together inhibit protein phosphatase
Supplemental Online Material. The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/-
#1074683s 1 Supplemental Online Material Materials and Methods Cell lines and tissue culture The mouse embryonic fibroblast cell line #10 derived from β-arrestin1 -/- -β-arrestin2 -/- knock-out animals
Measurement of peritoneal macrophage apoptosis by Celigo plate imaging cytometer
SUPPLEMENTAL METHODS Measurement of peritoneal macrophage apoptosis by Celigo plate imaging cytometer For Celigo experiments, 0.1 ml containing 5 x 10 4 cells was seeded into 96 well plates for 30 min
Supplemental Materials
Supplemental Materials Flores-Pérez et al., Supplemental Materials, page 1 of 5 Supplemental Figure S1. Pull-down and BiFC controls, and quantitative analyses associated with the BiFC studies. (A) Controls
To investigate the heredity of the WFP gene, we selected plants that were homozygous
Supplementary information Supplementary Note ST-12 WFP allele is semi-dominant To investigate the heredity of the WFP gene, we selected plants that were homozygous for chromosome 1 of Nipponbare and heterozygous
Supplemental Figure 1
Supplemental Figure 1 A a T7E1 + T7E1 - b T7E1 - T7E1 + Indels(%)
Cell death analysis using the high content bioimager BD PathwayTM 855 instrument (BD
Supplemental information Materials and Methods: Cell lines, reagents and antibodies: Wild type (A3) and caspase-8 -/- (I9.2) Jurkat cells were cultured in RPMI 164 medium (Life Technologies) supplemented
(A-B) P2ry14 expression was assessed by (A) genotyping (upper arrow: WT; lower
Supplementary Figures S1. (A-B) P2ry14 expression was assessed by (A) genotyping (upper arrow: ; lower arrow: KO) and (B) q-pcr analysis with Lin- cells, The white vertical line in panel A indicates that
Supplementary Information (Ha, et. al) Supplementary Figures Supplementary Fig. S1
Supplementary Information (Ha, et. al) Supplementary Figures Supplementary Fig. S1 a His-ORMDL3 ~ 17 His-ORMDL3 GST-ORMDL3 - + - + IPTG GST-ORMDL3 ~ b Integrated Density (ORMDL3/ -actin) 0.4 0.3 0.2 0.1
Supplementary Figure 1 Collision-induced dissociation (CID) mass spectra of peptides from PPK1, PPK2, PPK3 and PPK4 respectively.
Supplementary Figure 1 lision-induced dissociation (CID) mass spectra of peptides from PPK1, PPK, PPK3 and PPK respectively. % of nuclei with signal / field a 5 c ppif3:gus pppk1:gus 0 35 30 5 0 15 10
Nature Structural & Molecular Biology: doi: /nsmb.3308
Supplementary Figure 1 Analysis of CED-3 autoactivation and CED-4-induced CED-3 activation. (a) Repeat experiments of Fig. 1a. (b) Repeat experiments of Fig. 1b. (c) Quantitative analysis of three independent
Recruitment of Grb2 to surface IgG and IgE provides antigen receptor-intrinsic costimulation to class-switched B cells
SUPPLEMENTARY FIGURES Recruitment of Grb2 to surface IgG and IgE provides antigen receptor-intrinsic costimulation to class-switched B cells Niklas Engels, Lars Morten König, Christina Heemann, Johannes
Supplementary Information
Silva et al, 2006 Supplementary Information Nanog promotes transfer of pluripotency after cell fusion Supplementary Methods Antibodies RT-PCR analysis Trichostatin A and 5-azacytidine treatment Imaging
To determine the effect of N1IC in the susceptibility of T cells to the tolerogenic effect of tumorassociated
Supplementary Methods Tolerogenic effect of MDSC To determine the effect of N1IC in the susceptibility of T cells to the tolerogenic effect of tumorassociated MDSC in vivo, we used a model described previously
Coleman et al., Supplementary Figure 1
Coleman et al., Supplementary Figure 1 BrdU Merge G1 Early S Mid S Supplementary Figure 1. Sequential destruction of CRL4 Cdt2 targets during the G1/S transition. HCT116 cells were synchronized by sequential
produced in this study characterized using 3-8 % gradient SDS-PAGE under reducing
Supplementary Figure 1 Characterisation of newly produced laminins. Human recombinant LN-521 produced in this study characterized using 3-8 % gradient SDS-PAGE under reducing 1 and non-reducing conditions.
Supplementary Figure 1. Mouse genetic models used for identification of Axin2-
Supplementary Figure 1. Mouse genetic models used for identification of Axin2- expressing cells and their derivatives. Schematic representations illustrate genetic cell labeling strategies to identify
SUPPLEMENTARY INFORMATION
doi:10.1038/nature12119 SUPPLEMENTARY FIGURES AND LEGENDS pre-let-7a- 1 +14U pre-let-7a- 1 Ddx3x Dhx30 Dis3l2 Elavl1 Ggt5 Hnrnph 2 Osbpl5 Puf60 Rnpc3 Rpl7 Sf3b3 Sf3b4 Tia1 Triobp U2af1 U2af2 1 6 2 4 3
Supplementary Figure 1 Muscle dystrophic phenotype is absent at P6 in PKO mice. (a) Size
Supplementary Figure 1 Muscle dystrophic phenotype is absent at P6 in PKO mice. (a) Size comparison of the P6 control and PKO mice. (b) H&E staining of hind-limb muscles from control and PKO mice at P6.
Khaled_Fig. S MITF TYROSINASE R²= MITF PDE4D R²= Variance from mean mrna expression
Khaled_Fig. S Variance from mean mrna expression.8 2 MITF.6 TYROSINASE.4 R²=.73.2.8.6.4.2.8.6.4.2.8.6.4.2 MALME3M SKMEL28 UACC257 MITF PDE4D R²=.63 4.5 5 MITF 3.5 4 PDE4B 2.5 3 R²=.2.5 2.5.8.6.4.2.8.6.4.2