Supplementary Figure S1. Expression of complement components in E4 chick eyes. (a) A
|
|
- Rosamund Woods
- 5 years ago
- Views:
Transcription
1 Supplementary Figure S1. Expression of complement components in E4 chick eyes. (a) A schematic of the eye showing the ciliary margin (CM) of the anterior region, and the neuroepithelium (NE) and retinal pigmented epithelium (RPE) of the posterior region labeled to
2 be used as reference for all figures. The pigmented epithelium (PE) in the anterior region connects with the RPE in the posterior region, while the CM joins the NE. The NE will develop into the retina as the eye develops. Also, pigmentation becomes more pronounced as the eye develops, in both the anterior and posterior regions. Boxed areas represent regions used for RT- PCRs and regions magnified in the immunohistochemical staining panel (d). (b) Expression of Complement factors B (416 bp), D (444 bp), H (327 bp) and I (407 bp), and C3 (231 bp), C5 (228 bp), C3aR (230 bp), and C5aR (278 bp) mrna in E4 whole eye (WE), CM, RPE, and NE. Rdh10 (139 bp), Mitf (199 bp), and Cath5(149 bp) are specifically expressed in the CM, RPE and NE, respectively, and were used as positive controls for the different eye tissues, while GAPDH (432 bp) is ubiquitously expressed and therefore used as a standard control. (c) C3, C3 activation fragments, and C3aR were detected in eye tissues, yolk (Y) and albumin (A) by Western blotting using an antibody specific for the alpha-chain of chicken C3. The 115 kda band denotes C3 alpha chain while the 68 kda denotes ic3b and the 29 kda denotes the N- terminus alpha chain fragment and suggests further degradation to C3c and c3dg. Low levels of C3a (10 kda) can only be seen in chicken plasma that has been activated by cobra venom factor (CVF) using an anti C3a antibody. (d) Immuno-histochemical staining shows that C3 and C3aR are present in the anterior (A) and posterior (P) regions of the E4 chick eye, including the CM, NE, and RPE. Pre-immune serum was used as a negative control to show non-specific binding. The scale bar represents 20 m and applies to all panels. L= lens; M = Mesenchyme.
3 Supplementary Figure S2. C3 mrna and protein presence in response to injury. (a) Levels of C3 mrna detected by RT-qPCR in the CM at E4 before and after retinectomy. Expression is induced 2 h PR (P = ), and its expression is increased at 6 h (P = 0.001) and 24 h (P = ) PR. All P values were determined by comparing the level of C3 in developing eyes to the induction after retinectomy. Statistical analysis was determined using the Student s t test. Error bars represent s.e.m. All analyses were performed in triplicate with at least three independent biological samples. The mean ratio of C3 expression, s.e.m., and range are given in
4 Supplementary Table S5. *** = P value < (b) Western blotting using an antibody specific for the alpha-chain of chicken C3 shows that the level of activated C3 (ic3b= 68 kda) does not change after retina removal in E4 eyes at 2 h, 6 h, or 24 h PR. Levels of actin (42 kda) were used for normalization purposes. (c) Quantification of C3 in relation to actin levels. The exact binomial test was used for statistical analysis. n = 5 biological samples. The mean ratio of C3/actin, s.e.m., and range are given in Supplementary Table S3.
5 Supplementary Figure S3. Schematic of C3a and C3aR. (a) Schematic shows the cleavage of C3 alpha chain into C3a and C3b. The C-terminus sequence of C3a corresponds to the C3a peptide (C3a-p) used to induce retina regeneration. (b) Schematic of the C3a Receptor showing the region used to generate the C3aR-Ab.
6 Supplementary Figure S4. C5a-p induces chick retina regeneration. (a) Histological analysis at 3d PR shows the amount of regeneration from the stem/progenitor cells of the CM (cr) after treatment with C5a-p. Scale bar represents 100 m. (b) Graphical representation of the mean amount of regeneration induced by C5a-p (n = 8) compared to eyes treated by a peptide with a scrambled sequence (Scr) (n = 8). Error bars represent s.e.m. The mean, range and s.e.m. are provided in Supplementary Table S7. L= lens.
7 Supplementary Figure S5. FGF2 effects on C3 and C3aR expression. The expression of C3 and C3aR in eyes treated with FGF2 at 2 h and 24 h PR. Statistical analysis was determined by the Student s t- test. P value = for C3 expression at 2h PR in FGF2 treated eyes compared to eyes with retinectomy only. P value = for C3aR expression at 24h PR in FGF2 treated eyes compared to eyes with retinectomy only. n= 3 biological samples done in triplicate. ** = P < The level of C3 and C3aR expression is normalized to the level expressed in the CM of developing eyes at E4. Error bars represent s.e.m. The mean ratio of C3 and C3aR expression to GADPH expression as well as the s.e.m. and range are provided in Supplementary Table S5.
8 Supplementary Figure S6. Western blots used for the densitometry to measure the level of ps727 STAT3. (a) Representative Western blots used to calculate the mean ratio of ps727 STAT3 (86 kda) and actin (42 kda) shown in Fig. 5a and b. (b) A representative Western blot used to calculate the mean ratio of ps727 STAT3 and actin shown in Fig. 6g. Protein extracts from ciliary neurotrophic factor (CNTF) or interferon gamma (IFN)-treated DF-1 chick cells were used as a positive control for ps727 Stat3.
9 Supplementary Figure S7. IL-8 and TNF expression is stimulated by C3a-p. RT-qPCR shows the expression of IL-8 and TNF in the CM of eyes in response to Scr, C3a-p, C3a-p + C3aR-Ab, and C3a-p + IgG at 2 h PR. P= for IL-8 and 0.01 for TNF comparing C3a-p treated eyes to Scr treated eyes. P = for IL-8 and 0.001for TNF comparing C3a-p + IgG to C3a-p + C3aR-Ab. All expression values are normalized to the expression in eyes receiving retinectomy only. The Student s t-test was used for statistical analysis. n= 3 biological samples done in triplicate. Error bars represent s.e.m.the mean ratio of mrna for IL-8 and TNF relative to mrna for GADPH, as well as s.e.m. and range are given in Supplementary Table S6. * = P value < 0.05; **= P value < 0.01; *** = P value <
10 Supplementary Figure S8. CHIR up-regulates wnt2b and axin2 mrna. RT-qPCR shows the expression of wnt2b and axin2 in the CM at 24 h PR in response to treatment with the pharmacological agent CHIR All expression values are compared to the expression in the CM of eyes treated with DMSO only (control). P value = for wnt2b expression and 0.02 for axin2 expression. The Student s t-test was used for statistical analysis. n= 3 biological samples done in triplicate. Error bars represent s.e.m. The mean ratio of mrna for wnt2b and axin2 relative to mrna for GADPH, as well as s.e.m. and range are given in Supplementary Table S6. * = P value < 0.05; **= P value < 0.01.
11 Supplementary Figure S9. Increased concentration of C3a-p induces retina degeneration and apoptosis. (a) Histological analysis at 7d PR shows the amount of regeneration induced by increased concentration of C3a-p (100 g). (b and c) TUNEL analysis shows apoptotic cells at 7d PR in eyes treated with 100 g of C3a-p (b) and 50 g of C3a-p (c). Scale bar in (c) represents 100 m and applies to (b) as well. L= lens; cr= regeneration from the ciliary margin; RPE = retinal pigmented epithelium.
12 Gene Ensembl or GenBank ID Sequence 5-3 Factor B BI F, GCTGAAGGGGCAGGAGAC R, GTGTGGGGGCTCTGTCTGT Factor D XM_ F, GCAGCAACATCCACAACAAC R, CCATCACACCATCAATCCAC Factor H ENSGALG F, GGGCCTCTGGAAAATGGTTA R, TGGAGACCAGCCATTCTTTT Factor I ENSGALT F, AGGCAAACCAAAACATGAGG R, GCAGAGCGATGTCATTTTCA C3 ENSGALT F, TCCGTGAGGCTCATCAAGC R, TCGAGCCAGCTCGTATTGC C5 ENSGALG F, TCTGACTTTGAGGAGCAAG R, TCTTGCCAATATTAGAAGC C3aR ENSFM F, ACACAGGACCGATGGTTCTT R, GATGATGTTCACAGACCTCT C5aR ENSFM F, ATTTTCCTTCTGGGCATCCC R, GTGACCATAAGGCACCGATC Gapdh ENSGALG F, TCCAAACTCATTGTCATACCAGGAA R, ACCACTGTCCATGCCATCACAGCC Rdh10 ENSGALG F, AGGAATGTTCAGAGGGTGCAGGAT R, ATACATGAGGCGAGGTGTGCAGAT Mitf ENSGALG F, AAAGCATGCCTCCTCCAGGACTTA R, TTGGGTATCAAGGTGCCCAGTTCT Cath5 ENSGALT F, TGCAGAAGTGGATCAGGCTGTGTT R, TGTGGAACCACCTTCCTCAAACGA Supplementary Table S1. Primers Sequences for RT-PCR (5-3 ).
13 Name Sequence C3a C3a ( ) -p MRGSHHHHHHGSSVRLIKHKGTKMAEYSDKNLRKCCEDGMKENL MGYSCEKRATYVLDGKACTEAFLSCCLYIKGIRDEERELQYELAR H-LYIKGIRDEERELQYELAR-COOH C5a ( ) -p H-EFANRLREEEPSKLLILAR-COOH Scr H-EAYKQRYEDRLELRIELIG-COOH C3a ( ) antigen H-CLYIKGIRDEERELQYELAR-COOH C3 ( ) antigen H-SEVDDAFLSDEDITSRSLFPE-CONH 2 C3aR ( ) antigen H-DIRLLESESDLPHTSLPV-CONH 2 Supplementary Table S2. The sequences of the peptides and antigens used to make antibodies.
14 Treatment Ratio Mean s.e.m. Range E4 No Treatment C3/actin E4 Retinectomy 2 h PR C3/actin E4 No Treatment C3/actin E4 Retinectomy 6 h PR C3/actin E5 No Treatment C3/actin E4 Retinectomy 24 h PR C3/actin E4 Development ps727 STAT3/actin E4 Retinectomy ps727 STAT3/actin C3a-p ps727 STAT3/actin Scr ps727 STAT3/actin C3a-p + IgG (1) ps727 STAT3/actin C3a-p + C3aR-Ab ps727 STAT3/actin C3a-p + IgG (2) ps727 STAT3/actin C3a-p + IL-6 Ab ps727 STAT3/actin Supplementary Table S3. Mean ratio of C3 to actin or ps727 STAT3 to actin with s.e.m. and range. Each set of biological samples were run on separate gels but all comparisons were done within the same gel. C3a-p + IgG (1) was compared to C3a-p + C3aR-Ab and C3a-p + IgG (2) was compared to C3a + IL-6 Ab.
15 Gene Ensembl or GenBank ID Sequence 5-3 C3 ENSGALT F, TCATCAAGCACAAGGGCACCAAGA R, TTTCCTTCATGCCGTCCTCACAG C3aR ENSFM F, GGCATAATCACAGCAGCTCA R, GATGTCAGGATAGGCAGACGA Gapdh ENSGALG F, CCATGTTTGTGATGGGTGTC R, CTCCACAATGCCAAAGTTGT FGF2 ENSGALG F, TGCAGCTTCAAGCAGAAGAA R, CATGCACTGGCTGTGAGTTC IL6 ENSGALG F, TCGCCTTTCAGACCTACCTG R, TGACCACTTCATCGGGATTT Sox2 ENSGALG F, TGAACGGATCGCCTACCTAC R, CTGGATTCCGTCTTGACCAC Wnt2b ENSGALG F, GATCCGTGAGTGCCAGTACC R, GAGGAGATGGCGTAGACGAA Six3 NM_ F, CCCCACGAAGAGTTGTCAAT R, TATGTCTCCGGTCTCCTCCA Axin2 ENSGALG F, ACCCACCTCTCCCTCCACT R, GCGATGCTCTCCACTCCTC Supplementary Table S4. Primers Sequences for RT-qPCR (5-3 ).
16 Treatment Gene Mean s.e.m. Range C3a-p (2h) FGF Scr (2h) FGF C3a-p (24 h) FGF Scr (24 h) FGF h PR C h PR C h PR C FGF2 (2 h PR) C FGF2 24 h PR) C FGF2 (2 h PR) C3aR FGF2 (24 h PR) C3aR Supplementary Table S5. Mean ratio of fold change mrna levels for the gene of interest to the level of mrna for GADPH with s.e.m. and range.
17 Treatment Gene Mean s.e.m. Range Scr IL C3a-p IL C3a-p + DMSO IL C3a-p + PD98059 IL C3a-p+ Stattic IL C3a-p + IgG IL C3a-p + C3aR-Ab IL Scr Wnt2b C3a-p Wnt2b C3a-p + DMSO Wnt2b C3a-p + PD98059 Wnt2b C3a-p + Stattic Wnt2b C3a-p + IgG Wnt2b C3-pa + C3aR-Ab Wnt2b Scr Six C3a-p Six C3a-p + DMSO Six C3a-p + PD98059 Six C3a-p + Stattic Six C3a-p + IgG Six C3a-p + C3aR-Ab Six Scr Sox C3a-p Sox C3a-p + DMSO Sox C3a-p +PD98059 Sox C3a-p + Stattic Sox C3a-p + IgG Sox C3a-p + C3aR-Ab Sox Scr IL C3a-p IL C3a-p +IgG IL
18 C3a-p + C3aR-Ab IL Scr TNFα C3a-p TNF α C3a-p + IgG TNF α C3a-p + C3aR-Ab TNF α CHIR 9021 Wnt2b CHIR 9021 Axin Supplementary Table S6. Mean ratio of fold change mrna levels for the gene of interest to the level of mrna for GADPH with s.e.m. and range for each treatment.
19 Stage/Treatment Mean Measurement s.e.m. Range ( eyes with regeneration/n) 3d PR Scrambled C3a (Scr) (0/8) 3d PR FGF (10/10) 3d PR C3a (5/7) 3d PR C3a-p (9/11) 3d PR C5a-p (7/8) 7d PR FGF (9/10) 7d PR C3a-p (8/12) 3d PR FGF2 Transdifferentiation (9/10) 3d PR C3a-p Transdifferentiation and 73 (2/11) 7d PR FGF2 Transdifferentiation (9/10) 7d PR C3a-p Transdifferentiation (1/12) 3d PR C3a-p + DMSO (7/9) 3d PR C3a-p + PD (6/8) 3d PR FGF2 + PD (0/5) 3d PR FGF2 + C3aR-Ab (12/14) 3d PR C3a-p + IgG (5/7) 3d PR C3a-p + C3aR- Ab (1/9) 3d PR C3a-p + PD (1/9) 3d PR FGF2 + PD (1/5) 3d PR C3a-p + Stattic (4/9) 3d PR IL (8/10)
20 3d PR DPBS (0/6) 3d PR C3a-p + IL-6 Ab and 1070 (2/8) 3d PR C3a-p + CHIR (6/16) 3d PR C3a-p + DMSO (CHIR equivalent) (8/11) Supplementary Table S7. Mean measurement of regeneration with s.e.m. and range for each treatment.
21 Treatment Area Counted Antibody Mean s.e.m. Range 3d PR FGF2 Anterior BrdU d PR C3a-p Anterior BrdU d PR FGF2 Posterior BrdU d PR C3a-p Posterior BrdU d PR FGF2 Anterior BrdU d C3a-p Anterior BrdU d PR FGF2 Posterior BrdU d PR C3a-p Posterior BrdU d PR FGF2 Anterior Chx10/Pax d PR C3a-p Anterior Chx10/Pax d PR FGF2 Anterior Chx10/Pax d PR C3a-p Anterior Chx10/Pax E11 Posterior Brn3a d PR FGF2 Posterior Brn3a d PR C3a-p Posterior Brn3a E11 Posterior AP d PR FGF2 Posterior AP d PR C3a-p Posterior AP E11 Posterior Chx d PR FGF2 Posterior Chx d PR C3a-p Posterior Chx E11 Posterior Pax d PR FGF2 Posterior Pax d PR C3a-p Posterior Pax E11 Posterior Visinin d PR FGF2 Posterior Visinin d PR C3a-p Posterior Visinin Supplementary Table S8. Mean number of immunopositive cells with s.e.m. and range comparing the number of proliferating cells, progenitors, and/or differentiated cells during C3a-p and FGF2 induced regeneration as well as in developing retina at E11.
Resveratrol inhibits epithelial-mesenchymal transition of retinal. pigment epithelium and development of proliferative vitreoretinopathy
Resveratrol inhibits epithelial-mesenchymal transition of retinal pigment epithelium and development of proliferative vitreoretinopathy Keijiro Ishikawa, 1,2 Shikun He, 2, 3 Hiroto Terasaki, 1 Hossein
More informationCell proliferation was measured with Cell Counting Kit-8 (Dojindo Laboratories, Kumamoto, Japan).
1 2 3 4 5 6 7 8 Supplemental Materials and Methods Cell proliferation assay Cell proliferation was measured with Cell Counting Kit-8 (Dojindo Laboratories, Kumamoto, Japan). GCs were plated at 96-well
More informationSupplementary Figure 1. ERK signaling is not activated at early hypertension. a, Western blot analysis for the level of phospho-erk (perk) and total
Supplementary Figure 1. ERK signaling is not activated at early hypertension. a, Western blot analysis for the level of phospho-erk (perk) and total ERK in the aortic tissue from the saline- or AngII-infused
More informationSupplementary Figure 1. jmj30-2 and jmj32-1 produce null mutants. (a) Schematic drawing of JMJ30 and JMJ32 genome structure showing regions amplified
Supplementary Figure 1. jmj30-2 and jmj32-1 produce null mutants. (a) Schematic drawing of JMJ30 and JMJ32 genome structure showing regions amplified by primers used for mrna expression analysis. Gray
More informationSupplementary Figure 1 Validate the expression of mir-302b after bacterial infection by northern
Supplementary Figure 1 Validate the expression of mir-302b after bacterial infection by northern blot. Northern blot analysis of mir-302b expression following infection with PAO1, PAK and Kp in (A) lung
More informationSupplementary Figure 1. Expressions of stem cell markers decreased in TRCs on 2D plastic. TRCs were cultured on plastic for 1, 3, 5, or 7 days,
Supplementary Figure 1. Expressions of stem cell markers decreased in TRCs on 2D plastic. TRCs were cultured on plastic for 1, 3, 5, or 7 days, respectively, and their mrnas were quantified by real time
More informationThe hedgehog pathway is a modulator of retina regeneration
Research article 4607 The hedgehog pathway is a modulator of retina regeneration Jason R. Spence*, Mayur Madhavan*, John D. Ewing, David K. Jones, Bret M. Lehman and Katia Del Rio-Tsonis Department of
More informationA cost-effective system for differentiation of intestinal epithelium from human induced pluripotent stem cells
A cost-effective system for differentiation of intestinal epithelium from human induced pluripotent stem cells Soichiro Ogaki 1, 2, 3, 4, 5, *, ayu orooka 1,*, Kaito Otera 1, 1, 3 and Shoen Kume Supplementary
More informationFig. S1. Effect of p120-catenin overexpression on the interaction of SCUBE2 with E-cadherin. The expression plasmid encoding FLAG.
Fig. S1. Effect of p120-catenin overexpression on the interaction of SCUBE2 with E-cadherin. The expression plasmid encoding FLAG.SCUBE2, E-cadherin.Myc, or HA.p120-catenin was transfected in a combination
More informationSTAT3 signaling controls satellite cell expansion and skeletal muscle repair
SUPPLEMENTARY INFORMATION STAT3 signaling controls satellite cell expansion and skeletal muscle repair Matthew Timothy Tierney 1 *, Tufan Aydogdu 2,3 *, David Sala 2, Barbora Malecova 2, Sole Gatto 2,
More informationFibroblast Growth Factor Hedgehog Interdependence During Retina Regeneration
DEVELOPMENTAL DYNAMICS 236:1161 1174, 2007 RESEARCH ARTICLE Fibroblast Growth Factor Hedgehog Interdependence During Retina Regeneration Jason R. Spence, Juan-Carlos Aycinena, and Katia Del Rio-Tsonis*
More informationSupplementary information for: Ten-Eleven Translocation-2 (Tet2) Is Involved in Myogenic Differentiation of Skeletal Myoblast Cells in
Supplementary information for: Ten-Eleven Translocation-2 (Tet2) Is Involved in Myogenic Differentiation of Skeletal Myoblast Cells in Vitro Xia Zhong*, Qian-Qian Wang*, Jian-Wei Li, Yu-Mei Zhang, Xiao-Rong
More informationmonoclonal antibody. (a) The specificity of the anti-rhbdd1 monoclonal antibody was examined in
Supplementary information Supplementary figures Supplementary Figure 1 Determination of the s pecificity of in-house anti-rhbdd1 mouse monoclonal antibody. (a) The specificity of the anti-rhbdd1 monoclonal
More informationSupplementary Figure 1 Muscle dystrophic phenotype is absent at P6 in PKO mice. (a) Size
Supplementary Figure 1 Muscle dystrophic phenotype is absent at P6 in PKO mice. (a) Size comparison of the P6 control and PKO mice. (b) H&E staining of hind-limb muscles from control and PKO mice at P6.
More informationSupplementary Fig. S1. Schematic representation of mouse lines Pax6 fl/fl and mrx-cre used in this study. (A) To generate Pax6 fl/ fl
Supplementary Fig. S1. Schematic representation of mouse lines Pax6 fl/fl and mrx-cre used in this study. (A) To generate Pax6 fl/ fl, loxp sites flanking exons 3-6 (red arrowheads) were introduced into
More informationSupplementary Figure 1 a
3 min PMA 45 min PMA AnnexinV-FITC Supplementary Figure 1 5 min PMA 15 min PMA a 9 min PMA 12 min PMA 5 min FGF7 15 min FGF7 3 min FGF7 6 min FGF7 9 min FGF7 12 min FGF7 5 min control 3 min control 6 min
More informationb alternative classical none
Supplementary Figure. 1: Related to Figure.1 a d e b alternative classical none NIK P-IkBa Total IkBa Tubulin P52 (Lighter) P52 (Darker) RelB (Lighter) RelB (Darker) HDAC1 Control-Sh RelB-Sh NF-kB2-Sh
More informationSupplementary Table 1. Sequences for BTG2 and BRCA1 sirnas.
Supplementary Table 1. Sequences for BTG2 and BRCA1 sirnas. Target Gene Non-target / Control BTG2 BRCA1 NFE2L2 Target Sequence ON-TARGET plus Non-targeting sirna # 1 (Cat# D-001810-01-05) sirna1: GAACCGACAUGCUCCCGGA
More informationGene Sequence Fragment size ΔEGFR F 5' GGGCTCTGGAGGAAAAGAAAG GT 3' 116 bp R 5' CTTCTTACACTTGCGGACGC 3'
Supplementary Table 1: Real-time PCR primer sequences for ΔEGFR, wtegfr, IL-6, LIF and GAPDH. Gene Sequence Fragment size ΔEGFR F 5' GGGCTCTGGAGGAAAAGAAAG GT 3' 116 bp R 5' CTTCTTACACTTGCGGACGC 3' wtegfr
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb3240 Supplementary Figure 1 GBM cell lines display similar levels of p100 to p52 processing but respond differentially to TWEAK-induced TERT expression according to TERT promoter mutation
More informationKhaled_Fig. S MITF TYROSINASE R²= MITF PDE4D R²= Variance from mean mrna expression
Khaled_Fig. S Variance from mean mrna expression.8 2 MITF.6 TYROSINASE.4 R²=.73.2.8.6.4.2.8.6.4.2.8.6.4.2 MALME3M SKMEL28 UACC257 MITF PDE4D R²=.63 4.5 5 MITF 3.5 4 PDE4B 2.5 3 R²=.2.5 2.5.8.6.4.2.8.6.4.2
More informationFig. S1. eif6 expression in HEK293 transfected with shrna against eif6 or pcmv-eif6 vector.
Fig. S1. eif6 expression in HEK293 transfected with shrna against eif6 or pcmv-eif6 vector. (a) Western blotting analysis and (b) qpcr analysis of eif6 expression in HEK293 T cells transfected with either
More informationSUPPORTING ONLINE MATERIAL
SUPPORTING ONLINE MATERIAL SUPPLEMENTAL EXPERIMENTAL PROCEDURES Primers for qpcr and semiquantitative PCR and conditions for semiquantitative PCR G6Pase 5 -ttgtggcagaagcatttgag-3, 5 -atatccttgcactggcaacc-3.
More informationSupplementary Figure 1. Generation of B2M -/- ESCs. Nature Biotechnology: doi: /nbt.3860
Supplementary Figure 1 Generation of B2M -/- ESCs. (a) Maps of the B2M alleles in cells with the indicated B2M genotypes. Probes and restriction enzymes used in Southern blots are indicated (H, Hind III;
More informationSupplementary Figure 1. TRIM9 does not affect AP-1, NF-AT or ISRE activity. (a,b) At 24h post-transfection with TRIM9 or vector and indicated
Supplementary Figure 1. TRIM9 does not affect AP-1, NF-AT or ISRE activity. (a,b) At 24h post-transfection with TRIM9 or vector and indicated reporter luciferase constructs, HEK293T cells were stimulated
More informationa Lamtor1 (gene) b Lamtor1 (mrna) c WT Lamtor1 Lamtor1 flox Lamtor2 A.U. p = LysM-Cre Lamtor3 Lamtor4 Lamtor5 BMDMs: Φ WT Φ KO β-actin WT BMDMs
a Lamtor (gene) b Lamtor (mrna) c BMDMs: Φ WT Φ KO Lamtor flox 8 bp LysM-Cre 93 bp..5 p =.4 WT BMDMs: Φ WT Φ KO Lamtor (protein) BMDMs: Φ WT Φ KO Lamtor 8 kda Lamtor 4 kda Lamtor3 4 kda Lamtor4 kda Lamtor5.5
More informationABSTRACT THE BMP SIGNALING PATHWAY: ITS ROLE IN RETINA REGENERATION. by Christian Gutierrez
ABSTRACT THE BMP SIGNALING PATHWAY: ITS ROLE IN RETINA REGENERATION by Christian Gutierrez The embryonic chick eye is an ideal model to study retina regeneration since it has the ability to regenerate
More informationA novel tool for monitoring endogenous alpha-synuclein transcription by NanoLuciferase
A novel tool for monitoring endogenous alpha-synuclein transcription by NanoLuciferase tag insertion at the 3 end using CRISPR-Cas9 genome editing technique Sambuddha Basu 1, 3, Levi Adams 1, 3, Subhrangshu
More informationSupplementary Table S1
Primers used in RT-qPCR, ChIP and Bisulphite-Sequencing. Quantitative real-time RT-PCR primers Supplementary Table S1 gene Forward primer sequence Reverse primer sequence Product TRAIL CAACTCCGTCAGCTCGTTAGAAAG
More informationSupplementary Fig. 1. A, Upper panel shows schematic molecular representation of mutation- and SNP-replacement with FANCA-c-HDAdV in FANCA-corrected
Supplementary Fig. 1. A, Upper panel shows schematic molecular representation of mutation- and SNP-replacement with FANCA-c-HDAdV in FANCA-corrected FA-iPSC line (C-FA-iPSCs). Lower panels show the sequencing
More informationRegulation of axonal and dendritic growth by the extracellular calcium-sensing
Regulation of axonal and dendritic growth by the extracellular calcium-sensing receptor (CaSR). Thomas N. Vizard, Gerard W. O Keeffe, Humberto Gutierrez, Claudine H. Kos, Daniela Riccardi, Alun M. Davies
More informationSupplemental Figure 1 (Figure S1), related to Figure 1 Figure S1 provides evidence to demonstrate Nfatc1Cre is a mouse line that directed gene
Developmental Cell, Volume 25 Supplemental Information Brg1 Governs a Positive Feedback Circuit in the Hair Follicle for Tissue Regeneration and Repair Yiqin Xiong, Wei Li, Ching Shang, Richard M. Chen,
More informationSupplementary Figure 1.
Supplementary Figure 1. Quantification of western blot analysis of fibroblasts (related to Figure 1) (A-F) Quantification of western blot analysis for control and IR-Mut fibroblasts. Data are expressed
More informationFigure S1. Figure S2. Figure S3 HB Anti-FSP27 (COOH-terminal peptide) Ab. Anti-GST-FSP27(45-127) Ab.
/ 36B4 mrna ratio Figure S1 * 2. 1.6 1.2.8 *.4 control TNFα BRL49653 Figure S2 Su bw AT p iw Anti- (COOH-terminal peptide) Ab Blot : Anti-GST-(45-127) Ab β-actin Figure S3 HB2 HW AT BA T Figure S4 A TAG
More informationImmunoglobulins. (1 of 2)
Immunoglobulins (1 of 2) Immunoglobulins (Igs) = antibodies Each B cell synthesizes Igs of single specificity for a specific epitope B cell receptors (BCRs) are the Igs on B cell surface Humoral immunity
More informationSupplementary Figure 1 PARP1 is involved in regulating the stability of mrnas from pro-inflammatory cytokine/chemokine mediators.
Supplementary Figure 1 PARP1 is involved in regulating the stability of mrnas from pro-inflammatory cytokine/chemokine mediators. (a) A graphic depiction of the approach to determining the stability of
More informationPE11, a PE/PPE family protein of Mycobacterium tuberculosis is involved in cell wall remodeling and virulence
PE11, a PE/PPE family protein of Mycobacterium tuberculosis is involved in cell wall remodeling and virulence Parul Singh 1,2, Rameshwaram Nagender Rao 1, Jala Ram Chandra Reddy 3, R.B.N. Prasad 3, Sandeep
More informationSupplementary data. sienigma. F-Enigma F-EnigmaSM. a-p53
Supplementary data Supplemental Figure 1 A sienigma #2 sienigma sicontrol a-enigma - + ++ - - - - - - + ++ - - - - - - ++ B sienigma F-Enigma F-EnigmaSM a-flag HLK3 cells - - - + ++ + ++ - + - + + - -
More informationSupplementary Materials for
advances.sciencemag.org/cgi/content/full/4/9/eaat5401/dc1 Supplementary Materials for GLK-IKKβ signaling induces dimerization and translocation of the AhR-RORγt complex in IL-17A induction and autoimmune
More informationRegulation of hepcidin expression by inflammation-induced activin B
Regulation of hepcidin expression by inflammation-induced activin B Yohei Kanamori, Makoto Sugiyama, Osamu Hashimoto, Masaru Murakami, Tohru Matsui and Masayuki Funaba Supplemental methods Liver cell separation
More informationSupplementary Materials: Viral Protein Kinetics of Piscine Orthoreovirus Infection in Atlantic Salmon Blood Cells
S1of S7 Supplementary Materials: Viral Protein Kinetics of Piscine Orthoreovirus Infection in Atlantic Salmon Blood Cells Hanne Merethe Haatveit, Øystein Wessel, Turhan Markussen, Morten Lund, Bernd Thiede,
More informationTable S1. Primers used in RT-PCR studies (all in 5 to 3 direction)
Table S1. Primers used in RT-PCR studies (all in 5 to 3 direction) Epo Fw CTGTATCATGGACCACCTCGG Epo Rw TGAAGCACAGAAGCTCTTCGG Jak2 Fw ATCTGACCTTTCCATCTGGGG Jak2 Rw TGGTTGGGTGGATACCAGATC Stat5A Fw TTACTGAAGATCAAGCTGGGG
More informationa KYSE270-CON KYSE270-Id1
a KYSE27-CON KYSE27- shcon shcon sh b Human Mouse CD31 Relative MVD 3.5 3 2.5 2 1.5 1.5 *** *** c KYSE15 KYSE27 sirna (nm) 5 1 Id2 Id2 sirna 5 1 sirna (nm) 5 1 Id2 sirna 5 1 Id2 [h] (pg per ml) d 3 2 1
More informationSupplementary Data. Supplementary Table S1.
Supplementary Data Supplementary Table S1. Primer Sequences for Real-Time Reverse Transcription-Polymerase Chain Reaction Gene Forward 5?3 Reverse 3?5 Housekeeping gene 36B4 TCCAGGCTTTGGGCATCA CTTTATCAGCTGCACATCACTCAGA
More informationSupplemental Figure 1: Podocyte specific knockdown of Klf4 in Podocin-Cre Klf4 flox/flox mice was confirmed. (A) Primary glomerular epithelial cells
Supplemental Figure 1: Podocyte specific knockdown of Klf4 in Podocin-Cre Klf4 flox/flox mice was confirmed. (A) Primary glomerular epithelial cells were isolated from 10-week old Podocin-Cre Klf4 flox/flox
More informationSupplementary Figures
Supplementary Figures Supplementary Figure 1. Effect of timing of DE dissociation and RA concentration on lung field specification in hpscs. (a) Effect of duration of endoderm induction on expression of
More informationSupplementary Figure 1. Characterization of the POP2 transcriptional and post-transcriptional regulatory elements. (A) POP2 nucleotide sequence
1 5 6 7 8 9 10 11 1 1 1 Supplementary Figure 1. Characterization of the POP transcriptional and post-transcriptional regulatory elements. (A) POP nucleotide sequence depicting the consensus sequence for
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/8/362/ra12/dc1 Supplementary Materials for FOXP1 potentiates Wnt/β-catenin signaling in diffuse large B cell lymphoma Matthew P. Walker, Charles M. Stopford, Maria
More informationNotch1 (forward: 5 -TGCCTGTGCACACCATTCTGC-3, reverse: Notch2 (forward: 5 -ATGCACCATGACATCGTTCG-3, reverse:
Supplementary Information Supplementary Methods. RT-PCR. For mouse ES cells, the primers used were: Notch1 (forward: 5 -TGCCTGTGCACACCATTCTGC-3, reverse: 5 -CAATCAGAGATGTTGGAATGC-3 ) 1, Notch2 (forward:
More informationTable 1. Primers, annealing temperatures, and product sizes for PCR amplification.
Table 1. Primers, annealing temperatures, and product sizes for PCR amplification. Gene Direction Primer sequence (5 3 ) Annealing Temperature Size (bp) BRCA1 Forward TTGCGGGAGGAAAATGGGTAGTTA 50 o C 292
More informationSupplementary Information (Ha, et. al) Supplementary Figures Supplementary Fig. S1
Supplementary Information (Ha, et. al) Supplementary Figures Supplementary Fig. S1 a His-ORMDL3 ~ 17 His-ORMDL3 GST-ORMDL3 - + - + IPTG GST-ORMDL3 ~ b Integrated Density (ORMDL3/ -actin) 0.4 0.3 0.2 0.1
More informationSupplemental Table 1 Primers used in study. Human. Mouse
Supplemental Table 1 Primers used in study Human Forward primer region(5-3 ) Reverse primer region(5-3 ) RT-PCR GAPDH gagtcaacggatttggtcgt ttgattttggagggatctcg Raftlin atgggttgcggattgaacaagttaga ctgaggtataacaccaacgaatttcaggc
More informationSUPPLEMENTARY INFORMATION
(Supplementary Methods and Materials) GST pull-down assay GST-fusion proteins Fe65 365-533, and Fe65 538-700 were expressed in BL21 bacterial cells and purified with glutathione-agarose beads (Sigma).
More informationSupplementary Information
Supplementary Information MLL histone methylases regulate expression of HDLR- in presence of estrogen and control plasma cholesterol in vivo Khairul I. Ansari 1, Sahba Kasiri 1, Imran Hussain 1, Samara
More informationFlowcytometry-based purity analysis of peritoneal macrophage culture.
Liao et al., KLF4 regulates macrophage polarization Revision of Manuscript 45444-RG- Supplementary Figure Legends Figure S Flowcytometry-based purity analysis of peritoneal macrophage culture. Thioglycollate
More informationThe non-muscle-myosin-ii heavy chain Myh9 mediates colitis-induced epithelium injury by restricting Lgr5+ stem cells
Supplementary Information The non-muscle-myosin-ii heavy chain Myh9 mediates colitis-induced epithelium injury by restricting Lgr5+ stem cells Bing Zhao 1,3, Zhen Qi 1,3, Yehua Li 1,3, Chongkai Wang 2,
More informationSupplementary Figure S1. N-terminal fragments of LRRK1 bind to Grb2.
Myc- HA-Grb2 Mr(K) 105 IP HA 75 25 105 1-1163 1-595 - + - + - + 1164-1989 Blot Myc HA total lysate 75 25 Myc HA Supplementary Figure S1. N-terminal fragments of bind to Grb2. COS7 cells were cotransfected
More informationUtility of the dual-specificity protein kinase TTK as a therapeutic target
Utility of the dual-specificity protein kinase TTK as a therapeutic target for intrahepatic spread of liver cancer Ruoyu Miao, 1,2* Yan Wu, 2* Haohai Zhang, 1 Huandi Zhou, 3 Xiaofeng Sun, 2 Eva Csizmadia,
More informationWT Day 90 after injections
Supplementary Figure 1 a Day 1 after injections Day 9 after injections Klf5 +/- Day 1 after injections Klf5 +/- Day 9 after injections BLM PBS b Day 1 after injections Dermal thickness (μm) 3 1 Day 9 after
More informationSupplementary Fig. 1 Proteomic analysis of ATR-interacting proteins. ATR, ARID1A and
Supplementary Figure Legend: Supplementary Fig. 1 Proteomic analysis of ATR-interacting proteins. ATR, ARID1A and ATRIP protein peptides identified from our mass spectrum analysis were shown. Supplementary
More informationAt E17.5, the embryos were rinsed in phosphate-buffered saline (PBS) and immersed in
Supplementary Materials and Methods Barrier function assays At E17.5, the embryos were rinsed in phosphate-buffered saline (PBS) and immersed in acidic X-gal mix (100 mm phosphate buffer at ph4.3, 3 mm
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION Legends for Supplementary Tables. Supplementary Table 1. An excel file containing primary screen data. Worksheet 1, Normalized quantification data from a duplicated screen: valid
More informationRegulation of transcription by the MLL2 complex and MLL complex-associated AKAP95
Supplementary Information Regulation of transcription by the complex and MLL complex-associated Hao Jiang, Xiangdong Lu, Miho Shimada, Yali Dou, Zhanyun Tang, and Robert G. Roeder Input HeLa NE IP lot:
More informationSupplementary Figure S1. Immunodetection of full-length XA21 and the XA21 C-terminal cleavage product.
Supplementary Information Supplementary Figure S1. Immunodetection of full-length XA21 and the XA21 C-terminal cleavage product. Total protein extracted from Kitaake wild type and rice plants carrying
More informationNature Structural and Molecular Biology: doi: /nsmb Supplementary Figure 1
Supplementary Figure 1 Distribution of mirnas between lncrna and protein-coding genes. Pie chart showing distribution of human mirna between protein coding and lncrna genes. To the right, lncrna mirna
More informationSupplementary Fig. 1 related to Fig. 1 Clinical relevance of lncrna candidate
Supplementary Figure Legends Supplementary Fig. 1 related to Fig. 1 Clinical relevance of lncrna candidate BC041951 in gastric cancer. (A) The flow chart for selected candidate lncrnas in 660 up-regulated
More informationSupplemental figure 1: Phenotype of IMC and MDSC after purification. A. Gating
Supplemental Figure Legend: Supplemental figure 1: Phenotype of IMC and MDSC after purification. A. Gating strategy for mouse MDSC. CD11b + Ly6C high Ly6G - cells are defined as M-MDSC. CD11b + Ly6C low
More informationSupplementary figures (Zhang)
Supplementary figures (Zhang) Supplementary figure 1. Characterization of hesc-derived astroglia. (a) Treatment of astroglia with LIF and CNTF increases the proportion of GFAP+ cells, whereas the percentage
More informationNature Genetics: doi: /ng Supplementary Figure 1
Supplementary Figure 1 Characterization of Hi-C/CHi-C dynamics and enhancer identification. (a) Scatterplot of Hi-C read counts supporting contacts between domain boundaries. Contacts enclosing domains
More informationPositive selection gates for the collection of LRCs or nonlrcs had to be drawn based on the location and
Determining positive selection gates for LRCs and nonlrcs Positive selection gates for the collection of LRCs or nonlrcs had to be drawn based on the location and shape of the Gaussian distributions. For
More informationReceptor Revision Diminishes the Autoreactive B Cell Response after Antigen. PNA Tet. Day 8. Day 16
Receptor Revision Diminishes the Autoreactive Cell Response after Antigen Activation Ying-Hua Wang and etty Diamond Supplemental data: PNA Tet 5 8 11 16 Supplemental Figure 1: Kinetic analysis of tetramer-binding
More informationSupplemental Fig. 1: PEA-15 knockdown efficiency assessed by immunohistochemistry and qpcr
Supplemental figure legends Supplemental Fig. 1: PEA-15 knockdown efficiency assessed by immunohistochemistry and qpcr A, LβT2 cells were transfected with either scrambled or PEA-15 sirna. Cells were then
More informationReprogramming of the chick retinal pigmented epithelium after retinal injury
Reprogramming of the chick retinal pigmented epithelium after retinal injury Luz-Madrigal et al. Luz-Madrigal et al. BMC Biology 2014, 12:28 Luz-Madrigal et al. BMC Biology 2014, 12:28 RESEARCH ARTICLE
More informationSupplementary Figure 1. Antigens generated for mab development (a) K9M1P1-mIgG and hgh-k9m1p1 antigen (~37 kda) expression verified by western blot
Supplementary Figure 1. Antigens generated for mab development (a) K9M1P1-mIgG and hgh-k9m1p1 antigen (~37 kda) expression verified by western blot (vector: ~25 kda). (b) Silver staining was used to assess
More informationSupplementary Figure 1. Gating strategy for flow cytometry analysis of mouse aorta. Cell suspensions from mouse aorta digested with enzyme cocktail
Supplementary Figure 1. Gating strategy for flow cytometry analysis of mouse aorta. Cell suspensions from mouse aorta digested with enzyme cocktail were stained with propidium iodide (PI), anti-cd45 (FITC),
More informationSupplementary information Activation of AMP-activated protein kinase
Supplementary information Activation of AMP-activated protein kinase 2 by nicotine instigates formation of abdominal aortic aneurysms in mice in vivo Shuangxi Wang 1,2,5, Cheng Zhang 1,2,5, Miao Zhang
More informationFigure S1 is related to Figure 1B, showing more details of outer segment of
Supplemental Information Supplementary Figure legends and Figures Figure S1. Electron microscopic images in Sema4A +/+ and Sema4A / retinas Figure S1 is related to Figure 1B, showing more details of outer
More informationGrowth factor, augmenter of liver regeneration
Supplemental Table 1: Human and mouse PC1 sequence equivalencies Human Mouse Domain Clinical significance; Score* PolyPhen prediction; PSIC score difference C210G C210G WSC Highly likely pathogenic; 15
More informationNature Structural & Molecular Biology: doi: /nsmb Supplementary Figure 1. Analyses of ECTRs by C-circle and T-circle assays.
Supplementary Figure 1 Analyses of ECTRs by C-circle and T-circle assays. (a) C-circle and (b) T-circle amplification reactions using genomic DNA from different cell lines in the presence (+) or absence
More informationSupplementary Figure 1
Supplementary Figure 1 Virus infection induces RNF128 expression. (a,b) RT-PCR analysis of Rnf128 (RNF128) mrna expression in mouse peritoneal macrophages (a) and THP-1 cells (b) upon stimulation with
More informationisolated from ctr and pictreated mice. Activation of effector CD4 +
Supplementary Figure 1 Bystander inflammation conditioned T reg cells have normal functional suppressive activity and ex vivo phenotype. WT Balb/c mice were treated with polyi:c (pic) or PBS (ctr) via
More informationimmunofluorescence. Name of antibodies Manufacturer Catalog Number Rabbit anti-pdyn Rabbit anti-kor-1
Supplemental Tables Table S1. List of primary antibodies used for immunohistochemistry, FACS, and immunofluorescence. Name of antibodies Manufacturer Catalog Number Rabbit anti-pdyn Bioss USA bs-13041r
More informationCytotoxicity of Botulinum Neurotoxins Reveals a Direct Role of
Supplementary Information Cytotoxicity of Botulinum Neurotoxins Reveals a Direct Role of Syntaxin 1 and SNAP-25 in Neuron Survival Lisheng Peng, Huisheng Liu, Hongyu Ruan, William H. Tepp, William H. Stoothoff,
More informationInt. J. Mol. Sci. 2016, 17, 1259; doi: /ijms
S1 of S5 Supplementary Materials: Fibroblast-Derived Extracellular Matrix Induces Chondrogenic Differentiation in Human Adipose-Derived Mesenchymal Stromal/Stem Cells in Vitro Kevin Dzobo, Taegyn Turnley,
More informationWESTERN BLOT. BCH462- Practical
WESTERN BLOT BCH462- Practical What is Antigen [Ag]? What is Antibody [Ab]? Immunoassay: is a test that uses the highly specific and selective antigen-antibody reactions forming antibody and antigen complexes
More informationTime allowed: 2 hours Answer ALL questions in Section A, ALL PARTS of the question in Section B and ONE question from Section C.
UNIVERSITY OF EAST ANGLIA School of Biological Sciences Main Series UG Examination 2017-18 CELL BIOLOGY BIO-5005B Time allowed: 2 hours Answer ALL questions in Section A, ALL PARTS of the question in Section
More informationSupplemental material
Supplemental material THE JOURNAL OF CELL BIOLOGY Taylor et al., http://www.jcb.org/cgi/content/full/jcb.201403021/dc1 Figure S1. Representative images of Cav 1a -YFP mutants with and without LMB treatment.
More informationSupplementary Figure 1 Activated B cells are subdivided into three groups
Supplementary Figure 1 Activated B cells are subdivided into three groups according to mitochondrial status (a) Flow cytometric analysis of mitochondrial status monitored by MitoTracker staining or differentiation
More informationSupplemental Table/Figure Legends
MiR-26a is required for skeletal muscle differentiation and regeneration in mice Bijan K. Dey, Jeffrey Gagan, Zhen Yan #, Anindya Dutta Supplemental Table/Figure Legends Suppl. Table 1: Effect of overexpression
More informationSupplementary Figure 1 Collision-induced dissociation (CID) mass spectra of peptides from PPK1, PPK2, PPK3 and PPK4 respectively.
Supplementary Figure 1 lision-induced dissociation (CID) mass spectra of peptides from PPK1, PPK, PPK3 and PPK respectively. % of nuclei with signal / field a 5 c ppif3:gus pppk1:gus 0 35 30 5 0 15 10
More informationPrimers used for PCR of conductin, SGK1 and GAPDH have been described in (Dehner et al,
Supplementary METHODS Flow Cytometry (FACS) For FACS analysis, trypsinized cells were fixed in ethanol, rehydrated in PBS and treated with 40μg/ml propidium iodide and 10μ/ml RNase for 30 min at room temperature.
More informationSupplementary Information. HBx-upregulated lncrna UCA1 promotes cell growth and tumorigenesis
Supplementary Information HBx-upregulated lncrna UCA1 promotes cell growth and tumorigenesis by recruiting EZH2 and repressing p27kip1/cdk2 signaling Jiao-Jiao Hu 1, Wei Song 1, Shao-Dan Zhang 1, Xiao-Hui
More informationSupplementary Figure 1
Supplementary Figure 1 A THP-1 cells B THP-1 cells LPS + LPS + + EDTA C human monocytes D + EDTA LPS + LPS + +EDTA E control IgG 5 µg/ml IgG 50 µg/ml! F G Supplementary Figure 1: Binding of to THP-1 cells
More informationSupplemental Data. Wu et al. (2). Plant Cell..5/tpc RGLG Hormonal treatment H2O B RGLG µm ABA µm ACC µm GA Time (hours) µm µm MJ µm IA
Supplemental Data. Wu et al. (2). Plant Cell..5/tpc..4. A B Supplemental Figure. Immunoblot analysis verifies the expression of the AD-PP2C and BD-RGLG proteins in the Y2H assay. Total proteins were extracted
More informationNature Methods: doi: /nmeth Supplementary Figure 1. Validation of RaPID with EDEN15
Supplementary Figure 1 Validation of RaPID with EDEN15 (a) Full Western Blot of conventional biotinylated RNA pulldown with EDEN15 and scrambled control (n=3 biologically independent experiments, representative
More informationDevelopmental Reprogramming in Mesenchymal Stromal Cells of Human Subjects with Idiopathic Pulmonary Fibrosis
Developmental Reprogramming in Mesenchymal Stromal Cells of Human Subjects with Idiopathic Pulmonary Fibrosis Diptiman Chanda 1*, Ashish Kurundkar 1, Sunad Rangarajan 1, Morgan Locy 1, Karen Bernard 1,
More informationFig. S1 TGF RI inhibitor SB effectively blocks phosphorylation of Smad2 induced by TGF. FET cells were treated with TGF in the presence of
Fig. S1 TGF RI inhibitor SB525334 effectively blocks phosphorylation of Smad2 induced by TGF. FET cells were treated with TGF in the presence of different concentrations of SB525334. Cells were lysed and
More informationNovel cytokines in allergic disease
Novel cytokines in allergic disease By Soohyun Kim, PhD KonKuk University, Seoul Korea Content Introduction (cytokine functions in immune responses) Discovery of Interleukin-32 IL-32 binding protein (a
More informationSupplementary Data Supplementary Figure 1. Knockdown of VentX with a different sirna sequence reduces terminal monocyte to macrophage
Supplementary Data Supplementary Figure 1. Knockdown of VentX with a different sirna sequence reduces terminal monocyte to macrophage differentiation. Monocytes were transfected with either a scrambled
More informationSupplemental Materials. Matrix Proteases Contribute to Progression of Pelvic Organ Prolapse in Mice and Humans
Supplemental Materials Matrix Proteases Contribute to Progression of Pelvic Organ Prolapse in Mice and Humans Madhusudhan Budatha, Shayzreen Roshanravan, Qian Zheng, Cecilia Weislander, Shelby L. Chapman,
More information