Product Datasheet. Integrin alpha 3/CD49c Antibody NBP Unit Size: 0.1 ml

Transcription

1 Product Datasheet Integrin alpha 3/CD49c Antibody NBP Unit Size: 0.1 ml Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Protocols, Publications, Related Products, Reviews, Research Tools and Images at: Updated 3/18/2018 v.20.1 Earn rewards for product reviews and publications. Submit a publication at Submit a review at

2 NBP Integrin alpha 3/CD49c Antibody Product Information Unit Size Concentration Storage Clonality Preservative Isotype Purity Buffer Product Description Host 0.1 ml Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services. Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Polyclonal 0.02% Sodium Azide IgG Immunogen affinity purified PBS (ph 7.2) and 40% Glycerol Rabbit Gene ID 3675 Gene Symbol Species ITGA3 Human, Rat Reactivity Notes Mouse (84%). Specificity/Sensitivity Immunogen Product Application Details Applications Specificity of human, rat Integrin alpha 3/CD49c antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. This antibody was developed against a recombinant protein corresponding to amino acids: AQALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKL LLSINVTNTRTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGN PFKRNQRMELLIAFEVIGV Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin Recommended Dilutions Western Blot 0.4 ug/ml, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin 1:50-1:200 Application Notes Images For IHC-Paraffin, HIER ph 6 retrieval is recommended. in human cell lines U-251MG and HEK293 using anti-itga3 antibody. Corresponding ITGA3 RNA-seq data are presented for the same cell lines. Loading control: anti-hsp90b1. Page 1 of 4 v.20.1 Updated 3/18/2018

3 48514] - Staining in human lung and skeletal muscle tissues. Corresponding ITGA3 RNA-seq data are presented for the same tissues. Page 2 of 4 v.20.1 Updated 3/18/2018 in human cell line U-87 MG. in mouse cell line NIH-3T3 and rat cell line NBT-II ] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.

4 48514] - Staining of human lung cancer shows strong membranous positivity in tumor cells. Page 3 of 4 v.20.1 Updated 3/18/ ] - Staining of human lung shows strong membranous positivity in pneumocytes ] - Staining of human skeletal muscle shows no positivity in myocytes as expected ] - Staining of human small intestine shows strong membranous positivity in glandular cells.

5 Novus Biologicals USA 8100 Southpark Way, A-8 Littleton, CO USA Phone: Toll Free: Fax: Novus Biologicals Canada 461 North Service Road West, Unit B37 Oakville, ON L6M 2V5 Canada Phone: Toll Free: Fax: Novus Biologicals Europe 19 Barton Lane Abingdon Science Park Abingdon, OX14 3NB, United Kingdom Phone: (44) (0) Free Phone: Fax: (44) (0) General Contact Information Technical Support: Orders: General: Products Related to NBP NBP PEP HAF008 NB7156 NBP Integrin alpha 3/CD49c Recombinant Protein Antigen Goat anti-rabbit IgG Secondary Antibody [HRP (Horseradish Peroxidase)] Goat anti-rabbit IgG (H+L) Secondary Antibody Rabbit IgG Isotype Control Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt. For more information on our 100% guarantee, please visit Earn gift cards/discounts by submitting a review: Earn gift cards/discounts by submitting a publication using this product: