SUPPLEMENTARY INFORMATION
|
|
- Stuart Blankenship
- 5 years ago
- Views:
Transcription
1 doi: /nature05765 SUPPLEMENTARY INFORMATION Helicobacter pylori targets PAR1/MARK kinase to disrupt epithelial cell polarity Iraj Saadat 1, Hideaki Higashi 1, Chikashi Obuse 2, Mayumi Umeda 1, Naoko Murata-Kamiya 1, Yasuhiro Saito 1, Huaisheng Lu 1, Naomi Ohnishi 1, Takeshi Azuma 3, Atsushi Suzuki 4, Shigeo Ohno 4 & Masanori Hatakeyama 1 1 Division of Molecular Oncology, Institute for Genetic Medicine and Division of Chemistry, Graduate School of Science, Hokkaido University, Sapporo , Japan. 2 Faculty of Advanced Life Science, Hokkaido University, Sapporo , Japan. 3 Internal Center for Medical Research and Treatment, Kobe University Graduate School of Medicine, Kobe , Japan. 4 Department of Molecular Biology, Yokohama City University Graduate School of Medical Science, Yokohama , Japan. CONTENT Supplementary Figures (13) Supplementary table (1) References to supplementary information 1
2 Supplementary Figure 1 a Merge ZO-1 x-y (Apical) x-y (Middle) 3D (Downward) 3D (Upward) Merge ZO-1 b y-z x-z caga-positive H. pylori c Merge E- adherin Merge gp135 phalloidin Supplementary Figure 1 Mislocalization of ZO-1, E-cadherin and gp135 by. a, Confocal views of ZO-1 localization in MDCK cells expressing at 24 h after transfection of a vector. b, Compared with control, gastric mucosa infected with caga-positive H. pylori showed reduced ZO-1 staining at the tight junctions (ZO-1 ring), which was concomitantly associated with diffuse staining of ZO-1 along the lateral membranes. Informed consent was obtained from each patient after description of the nature and protocol of the study. c, Confocal x-z views of E-cadherin (upper) or gp135 (lower) localization in MDCK cells expressing at 24 h after transfection of a vector. Scale bar, 10 µm. 2
3 Supplementary Figure 2 -: PR Supplementary Figure 2 PR is not phosphorylated in MDCK cells. MDCK cells were transiently transfected with an expression vector for - or PR - in which all of the tyrosine residues that constitute EPIYA motifs were replaced by alanine residues 1. Cell lysates prepared were immunoblotted with an anti- or anti-phosphotyrosine antibody. 3
4 Supplementary Figure 3 ABCCC Supplementary Figure 3 Subcellular localization of ABCCC in non-polarized MDCK cells. Non-polarized MDCK cells were transfected with an expression vector for - or ABCCC - and were stained with an anti- antibody. Confocal x-y, x-z and y-z sectional views are shown. Scale bar, 10 µm. 4
5 Supplementary Figure 4 Supplementary Figure 4 Extrusion of -positive cells from polarized MDCK monolayer. Polarized MDCK cells were transfected with an expression vector for - and were stained with an anti- antibody (green). Confocal x-z views of stained cells are shown. -positive cells with bowlshaped morphology, which showed ZO-1, E-cadherin and gp135 mislocalizations, were extruded from the MDCK monolayer and were localized on top of the monolayer without showing any sign of apoptosis. Nuclei were stained with DAPI. Scale bar, 10 µm. 5
6 Supplementary Figure 5 MSSARTPLPT LNERDTEQPT LGHLDSKPSS KSNMIRGRNS ATSADEQPHI 50 GNYRLLKTIG KGNFAKVKLA RHILTGKEVA VKIIDKTQLN SSSLQKLFRE 100 VRIMKVLNHP NIVKLFEVIE TEKTLYLVME YASGGEVFDY LVAHGRMKEK 150 EARAKFRQIV SAVQYCHQKF IVHRDLKAEN LLLDADMNIK IADFGFSNEF 200 TFGNKLDTFC GSPPYAAPEL FQGKKYDGPE VDVWSLGVIL YTLVSGSLPF 250 DGQNLKELRE RVLRGKYRIP FYMSTDCENL LKKFLILNPS KRGTLEQIMK 300 DRWMNVGHED DELKPYVEPL PDYKDPRRTE LMVSMGYTRE EIQDSLVGQR 350 YNEVMATYLL LGYKSSELEG DTITLKPRPS ADLTNSSAPS PSHKVQRSVS 400 ANPKQRRFSD QAAGPAIPTS NSYSKKTQSN NAENKRPEED RESGRKASST 450 AKVPASPLPG LERKKTTPTP STNSVLSTST NRSRNSPLLE RASLGQASIQ 500 NGKDSLTMPG SRASTASASA AVSAARPRQH QKSMSASVHP NKASGLPPTE 550 SNCEVPRPST APQRVPVASP SAHNISSSGG APDRTNFPRG VSSRSTFG 600 QLRQVRDQQN LPYGVTPASP SGHSQGRRGA SGSIFSKFTS KFVRRNLSFR 650 FARRNLNEPE SKDRVETLRP HVVGSGGNDK EKEEFREAKP RSLRFTWSMK 700 TTSSMEPNEM MREIRKVLDA NSCQSELHEK YMLLCMHGTP GHEDFVQWEM 750 EVCKLPRLSL NGVRFKRISG TSMAFKNIAS KIANELKL 788 Supplementary Figure 5 Identification of PAR1b as a human protein that specifically binds to ABCCs but not ABCCC by mass spectrometric analysis. LC/MS/MS spectra of the tryptic peptides identified (lower panels) are shown in red characters along with the full amino-acid sequences of human PAR1b (ID number Q7KZI7: long splicing form consisting of 788 amino-acid residues), showing all peptides that were sequenced from PAR1b. It should be noted that PAR1b cdna (ID number: NM_017490) used in the present study encodes a short splicing form (745 amino acids). The short splicing form starts from residue 34 and contains two internal deletions, lack of residue 412 and deletion of residues , of the long splicing form. The sequences underlined with blue and green lines are identical to those of human PAR1c/MARK1 and PAR1a/MARK3, respectively. 6
7 Supplementary Figure 6 a c -: PAR1b-T7: ABCCC ABC PR IP: anti- ABCCC ABCC-s EPIYA segments A B C C C A B C PR ABCCC ABCC-s 1009 FPLKRHDKVDDLSKVGRSVSPEPIYATIDDLGGP---FPLKRHDKVDDLSKVGLSRNQELAQKIDNLSQAVSEAKAGFFSN AINRKIDRINKIASAGKGVGGFSGAGRSASPEPIYATIDFDEANQAGFPLRRSAAVNDLSKVGLSREQELTRRIGDLSQAVSEAKTGHFGN 1012 b d ABD IP: anti- -: PAR1b-T7: ABD EPIYA segments A B D A C C C ABD Number of CM ABD A B D ABCC-s : EPIYA motif : CM sequence ABCC e ABD ABD-16AA -: PAR1b-T7: IP: anti- ABD EPIYA segments ABD-16AA A B D : EPIYA motif : CM sequence ABD ABD-16AA f Bound PAR1b (-fold) : ABD ABC ABCCC Number of CM: : PAR1b-T7: ABCC-16AA 1025 IP: anti-t7 ABCC-s ABCC ABCC 16AA : EPIYA motif : CM sequence 0 ABCC-s ABCC ABCC 16AA Supplementary Figure 6 Delineation of region required for PAR1b interaction. a, COS-7 cells were transfected with a T7-tagged PAR1b vector together with - (ABCCC-type Western ) or its mutant vector (see also Fig. 1a). b, Schematic of ABD-type East Asian and its mutants used in this work (upper). COS- 7 cells were transfected with a T7-tagged PAR1b vector together with ABD - or its mutant vector. c, Sequence alignment of the residues of ABCCC-type Western and residues of ABD-type East Asian that are respectively required for the binding of Western and East Asian with PAR1b. The 16-amino-acid sequence boxed in red is the -multimerization (CM) sequence 2. Each of the EPIYA-C segments in Western contains a single CM sequence. Hence, ABC, a major form of Western, possesses two CM sequences, one within the EPIYA-C segment and the other immediately downstream of the EPIYA-C segment, and ABCCC possesses four CM sequences. On the other hand, ABD-type East Asian contains only a single CM sequence immediately downstream of the EPIYA-D segment 2. d, COS-7 cells were transfected with a PAR1b-T7 vector together with the expression vector for the Western mutant with various numbers of CM sequences. e, ABD-16AA was made by specifically deleting the 16-amino-acid CM sequence from East Asian ABD. COS-7 cells were transfected with a PAR1b-T7 vector together with ABD -, ABD-16AA - or control empty vector. (a, b, d, e) Total cell lysates () were subjected to immunoprecipitation (IP) with an anti- or anti-t7 antibody. The immunoprecipitates were immunoblotted (IB) with the indicated antibodies. f, COS-7 cells were transfected with a T7-tagged PAR1b vector together with ABCCC -, ABC - or ABD - vector. Cell lysates prepared were immunoprecipitated with an anti-t7 antibody and the immunoprecipitates were immunoblotted with an anti- antibody. Intensities of each protein bands were quantitated by a lumino-image analyzer. Relative amounts of -bound PAR1b were calculated from the immunoblotting data, defining the values in ABD as 1. Error bars are ± s.d. (n=3). 7
8 Supplementary Figure 7 PAR1b-T7 NH2 T7 292 COOH N Catalytic T UBA Spacer Tail PAR1b-T7: -: + IP: anti-t IP: anti-t PAR1b-T7: -: IP: anti-t Supplementary Figure 7 Delineation of PAR1b region required for interaction. COS-7 cells were transfected with the indicated vectors. Numbers shown on each PAR1b mutant represent residue deleted. Total cell lysates () were immunoprecipitated with the respective antibodies and the immunoprecipitates (IP) were immunoblotted (IB) with the indicated antibodies. 8
9 Supplementary Figure 8 a Catalytic domain T domain PAR1b 250 L LNPSKR WMNVGHE ELKP EP PAR1a PAR1c PAR1d LVLNP LVLNP KR KR W W N N GHE E GYE DELKP EELKP EELKP EP EP EP D D ND D RT KR KR KR M M M VM PAR1b PAR1a PAR1c PAR1d UBA domain VSMGYTREEIQDSLVGQRYNEVMATYLLLGYKSSELEG------DTITL- EI YN MATY LLGY E VGMGYSQEEIQESLSKMKYDEITATYLLLGRKSSELDASDSSSSSNLSLA EI KY LLGRK E VTMGFARDEINDALINQKYDEVMATYILLGRKPPEFEGGESLSSGNLCQ- MATY LLGRK E VGMGYTREEIKESLTSQKYNEVTATYLLLGRKTEEGGDRGAPGLALARVR EI KYN LLGRK E PAR1b S Spacer domain KQRR K PAR1a S KQRRY K PAR1c S KQRR K PAR1d S RQRRH K PAR1b PAR1a PAR1c KTQSNNAENKRPE 404 RSQTSTADSDLK- 446 RPQANSVESEQKE 429 b PAR1d -: PAR1a: IP: IB: anti-par1a anti- IB: anti-par1a RSPTSTGEAELK CCC ABCC s IP: anti- -: PAR1c-Myc: IB: anti-myc IB: anti-myc CCC ABCC-s IP: anti- -: PAR1d: IB: anti-par1d IB: anti-par1d CCC ABCC-s Supplementary Figure 8 Interaction of with PAR1 family kinases. a, Sequences are of human origin. Amino-acid sequences that are conserved among the PAR1 family are boxed in gray. Residues in PAR1b are essential for interaction. b, COS-7 cells were transfected with the or mutant - expression vector together with the PAR1a, Myc-tagged PAR1c or PAR1d expression vector. Total cell lysates () were immunoprecipitated with an anti- antibody and the immunoprecipitates (IP) were immunoblotted (IB) with the indicated antibodies. 9
10 Supplementary Figure 9 a PAR1b-T7 PAR1b-T b PAR1b-T7: tau: IB: anti-phosphotau (Ser-262) IB: anti-tau Supplementary Figure 9 Loss of kinase activity in PAR1b mutant lacking the -binding sequence. a, AGS cells were transfected with an expression vector for T7-tagged PAR1b or its mutant, PAR1b-T , that specifically lacks the -binding sequence (residues 250 to 276) and were stained with an anti-t7 antibody. Both and the mutant PAR1b were localized at the membrane. Scale bar, 10 µm. b, AGS cells were transfected with an expression vector for PAR1b-T7 or PAR1b-T together with a tau expression vector, and cell lysates were immunoblotted with an anti-tau or anti-phosphotau (Ser-262) antibody. 10
11 Supplementary Figure 10 a Dominant-negative PAR1b Merge ZO-1 PAR1b Merge E-cadherin PAR1b b ZO-1 mislocalization (%) : ABCC-16AA ABCC ABCCC Number of CM: Supplementary Figure 10 Involvement of -PAR1 interaction in the mislocalization of ZO-1 by. a, Confocal x-z views of ZO-1 and E-cadherin localization in MDCK cells expressing a dominant negative PAR1b, PAR1b MC 3. Scale bar, 10 µm. b, Percent ratio of ZO-1-mislocalized cells to total MDCK cells expressing indicated construct at 24 h after transfection. Error bars are ± s.d. (n=3). Note that ABCC-16AA - was made from ABCC - by specifically deleting the 16- amino-acid -multimerization (CM) sequence to which PAR1b binds (see Supplementary Fig. 6d, upper panel) 11
12 Supplementary Figure 11 a PAR1b apkc PAR1b PAR1b/aPKC PAR1b/aPKC/ PAR1b T595A/aPKC b d IB: anti-par1b IB: anti-apkc -: PAR1b-T7: anti-apkc normal rabbit IgG IP c IP: anti PAR1b-T7 -: apkc-flag IB: anti-flag IP: anti-t apkc-flag: IB: anti-phospho- PAR1b (Thr-595) IB: anti-phospho- PAR1b (Thr-208) IB: anti-flag Supplementary Figure 11 Effect of on the regulation of PAR1b by apkc. a, AGS cells were transfected with the indicated expression vectors and were stained for PAR1b, apkc and. Scale bar, 10 µm. b, Lysates prepared from AGS cells were immunoprecipitated with an anti-apkc antibody or control normal rabbit IgG and the immunoprecipitates were immunoblotted with an anti-par1b or apkc antibody. The result shows physical interaction between endogenous PAR1b and apkc in AGS cells. c, d, Lysates prepared from COS-7 cells transfected with the indicated vectors were immunoprecipitated with the respective antibodies. Total cell lysates () and immunoprecipitates (IP) were subjected to immunoblotting (IB) with the indicated antibody. 12
13 Supplementary Figure 12 a IP: anti-t7 -: PAR1b-T7: + + IB: anti-shp2 b -Flag: -: PAR1b-T7: IB: anti-flag IB: anti-shp2 IP: anti- Supplementary Figure 12 Effect of PAR1b on the -SHP2 interaction. a, COS-7 cells were cotransfected with - and PAR1b-T7 or control vector. Cell lysates were immunoprecipitated with an anti-t7 antibody and the anti-t7 immunoprecipitates were immunoblotted with the indicated antibodies. b, COS-7 cells were triple transfected with -, -Flag and PAR1b-T7 or control vector. Cell lysates were immunoprecipitated with an anti- antibody and the anti- immunoprecipitates were immunoblotted with the indicated antibodies. 13
14 Supplementary Figure 13 a PAR1 (dimer) -PAR1 interaction phosphorylation -SHP2 interaction Plasma membrane PAR1 PAR1 Src py lateral TJ PAR6 PAR3 Disruption of tight junctions Loss of apical-basolateral polarity PAR6 PAR3 PAR1 multimer apkc ZO-1 PAR1 multimer basal PAR1 P apical py py py SHP2 PAR1 kinase inhibition Impaired tight junctions Disruption of epithelial cell polarity SHP2 activation Hummingbird phenotype Sustained Erk activation b apkc P P SHP2 P P SHP2 ZO-1 P Inhibition of PAR1 kinase Activation of SHP2 Elevated cell motility Hummingbird phenotype in AGS cells TJ Supplementary Figure 13 Biological consequences of -PAR1 interaction. a, A sequential interaction model of with PAR1 and SHP2. PAR1 is present as a multimer, most probably a homodimer, in cells 4. ABC-type Western or ABD-type East Asian binds to the PAR1 dimer via the -multimerization (CM) sequence, which causes dimerization 2. Upon tyrosine phosphorylation by Src family kinases at the EPIYA-C or EPIYA-D segment, the dimerized proteins specifically interact with an SHP2 molecule via the two SH2 domains of SHP2 and thereby aberrantly activate SHP2 phosphatase, a bona-fide human oncoprotein 5. b, Upon complex formation, inhibits PAR1 kinase activity throughout the baso-lateral membrane, thereby inducing loss of apical-basolateral polarity of epithelial cells. Moreover, -associated PAR1 mislocalizes to the tight junctions and apical membrane domain because it does not undergo phosphorylation by apkc. Invasion of PAR1 to the tight junction may also perturb the tight junction function, which further contributes to disruption of epithelial cell polarity. 14
15 Supplementary Table 1 Supplementary Table 1 Proteins that bound to ABCC-s but not ABCCC. no. *IPI no. Mass Total score Peptide matched Annotation 1 IPI Splice Isoform 7 of Serine/threonine-protein kinase PAR1b/MARK2 2 IPI Polyadenylate-binding protein 1 3 IPI ER-resident protein ERdj5 4 IPI ATP-dependent RNA helicase A 5 IPI Splice Isoform 1 of Transcription intermediary factor 1-beta 6 IPI Membrane component, chromosome 11, surface marker 1, isoform 1 7 IPI ELKL motif kinase 2 long form *IPI : International Protein Index 15
16 References to supplementary information 1. Higashi, H. et al. SHP-2 tyrosine phosphatase as an intracellular target of Helicobacter pylori protein. Science 295, (2002). 2. Ren, S., Higashi, H., Lu, H., Azuma, T. & Hatakeyama, M. Structural basis and functional consequence of Helicobacter pylori multimerization in cells. J. Biol. Chem. 281, (2006). 3. Bohm, H., Brinkmann, V., Drab, M., Henske, A. & Kurzchalia, T. V. Mammalian homologues of C. elegans PAR-1 are asymmetrically localized in epithelial cells and may influence their polarity. Curr. Biol. 7, (1997). 4. Panneerselvam, S., Marx, A., Mandelkow, E. M. & Mandelkow, E. Structure of the catalytic and ubiquitin-associated domains of the protein kinase MARK/Par-1. Structure 14, (2006). 5. Hatakeyama, M. Oncogenic mechanisms of the Helicobacter pylori protein, Nat. Rev. Cancer 4, (2004). 16
T H E J O U R N A L O F C E L L B I O L O G Y
T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Nakajima and Tanoue, http://www.jcb.org/cgi/content/full/jcb.201104118/dc1 Figure S1. DLD-1 cells exhibit the characteristic morphology
More informationSupplementary Table 1. The Q-PCR primer sequence is summarized in the following table.
Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table. Name Sequence (5-3 ) Application Flag-u ggactacaaggacgacgatgac Shared upstream primer for all the amplifications of
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature09732 Supplementary Figure 1: Depletion of Fbw7 results in elevated Mcl-1 abundance. a, Total thymocytes from 8-wk-old Lck-Cre/Fbw7 +/fl (Control) or Lck-Cre/Fbw7 fl/fl (Fbw7 KO) mice
More informationFigure 1: TDP-43 is subject to lysine acetylation within the RNA-binding domain a) QBI-293 cells were transfected with TDP-43 in the presence or
Figure 1: TDP-43 is subject to lysine acetylation within the RNA-binding domain a) QBI-293 cells were transfected with TDP-43 in the presence or absence of the acetyltransferase CBP and acetylated TDP-43
More information(a) Immunoblotting to show the migration position of Flag-tagged MAVS
Supplementary Figure 1 Characterization of six MAVS isoforms. (a) Immunoblotting to show the migration position of Flag-tagged MAVS isoforms. HEK293T Mavs -/- cells were transfected with constructs expressing
More informationsupplementary information
DOI: 10.1038/ncb2156 Figure S1 Depletion of p114rhogef with different sirnas. Caco-2 (a) and HCE (b) cells were transfected with individual sirnas, pools of the two sirnas or the On Target (OnT) sirna
More informationPost-translational modification
Protein expression Western blotting, is a widely used and accepted technique to detect levels of protein expression in a cell or tissue extract. This technique measures protein levels in a biological sample
More informationb alternative classical none
Supplementary Figure. 1: Related to Figure.1 a d e b alternative classical none NIK P-IkBa Total IkBa Tubulin P52 (Lighter) P52 (Darker) RelB (Lighter) RelB (Darker) HDAC1 Control-Sh RelB-Sh NF-kB2-Sh
More informationSUPPLEMENTARY INFORMATION
(Supplementary Methods and Materials) GST pull-down assay GST-fusion proteins Fe65 365-533, and Fe65 538-700 were expressed in BL21 bacterial cells and purified with glutathione-agarose beads (Sigma).
More informationSupplemental Figure 1 Human REEP family of proteins can be divided into two distinct subfamilies. Residues (single letter amino acid code) identical
Supplemental Figure Human REEP family of proteins can be divided into two distinct subfamilies. Residues (single letter amino acid code) identical in all six REEPs are highlighted in green. Additional
More informationtranscription and the promoter occupancy of Smad proteins. (A) HepG2 cells were co-transfected with the wwp-luc reporter, and FLAG-tagged FHL1,
Supplementary Data Supplementary Figure Legends Supplementary Figure 1 FHL-mediated TGFβ-responsive reporter transcription and the promoter occupancy of Smad proteins. (A) HepG2 cells were co-transfected
More informationSupplementary Fig. 1 Identification of Nedd4 as an IRS-2-associated protein in camp-treated FRTL-5 cells.
Supplementary Fig. 1 Supplementary Fig. 1 Identification of Nedd4 as an IRS-2-associated protein in camp-treated FRTL-5 cells. (a) FRTL-5 cells were treated with 1 mm dibutyryl camp for 24 h, and the lysates
More informationJournal of Cell Science Supplementary Material
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 SUPPLEMENTARY FIGURE LEGENDS Figure S1: Eps8 is localized at focal adhesions and binds directly to FAK (A) Focal
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2271 Supplementary Figure a! WM266.4 mock WM266.4 #7 sirna WM266.4 #10 sirna SKMEL28 mock SKMEL28 #7 sirna SKMEL28 #10 sirna WM1361 mock WM1361 #7 sirna WM1361 #10 sirna 9 WM266. WM136
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION Dynamic Phosphorylation of HP1 Regulates Mitotic Progression in Human Cells Supplementary Figures Supplementary Figure 1. NDR1 interacts with HP1. (a) Immunoprecipitation using
More informationFig. S1. Effect of p120-catenin overexpression on the interaction of SCUBE2 with E-cadherin. The expression plasmid encoding FLAG.
Fig. S1. Effect of p120-catenin overexpression on the interaction of SCUBE2 with E-cadherin. The expression plasmid encoding FLAG.SCUBE2, E-cadherin.Myc, or HA.p120-catenin was transfected in a combination
More informationSupplementary Figure S1. Immunodetection of full-length XA21 and the XA21 C-terminal cleavage product.
Supplementary Information Supplementary Figure S1. Immunodetection of full-length XA21 and the XA21 C-terminal cleavage product. Total protein extracted from Kitaake wild type and rice plants carrying
More informationASPP1 Fw GGTTGGGAATCCACGTGTTG ASPP1 Rv GCCATATCTTGGAGCTCTGAGAG
Supplemental Materials and Methods Plasmids: the following plasmids were used in the supplementary data: pwzl-myc- Lats2 (Aylon et al, 2006), pretrosuper-vector and pretrosuper-shp53 (generous gift of
More informationSupplementary Figure Legends
Supplementary Figure Legends Supplementary Fig. 1. The third PDZ domain of PAR-3 and the C-terminal PDZ domain binding motif of VE-cadherin mediate the recruitment of PAR-3 to cell-cell contacts in cells.
More informationSupplementary Information
Supplementary Information Mutual reinforcement of inflammation and carcinogenesis by the Helicobacter pylori CagA oncoprotein Nobumi Suzuki, Naoko Murata-Kamiya, Kohei Yanagiya, Wataru Suda, Masahira Hattori,
More informationSupplemental material
Supplemental material THE JOURNAL OF CELL BIOLOGY Gillespie et al., http://www.jcb.org/cgi/content/full/jcb.200907037/dc1 repressor complex induced by p38- Gillespie et al. Figure S1. Reduced fiber size
More informationNature Structural & Molecular Biology: doi: /nsmb.1583
Acetylation by GCN5 regulates CDC6 phosphorylation in the S-phase of the cell cycle Roberta Paolinelli 1,2, Ramiro Mendoza-Maldonado 2, Anna Cereseto 1 and Mauro Giacca 2 1 Molecular Biology Laboratory,
More informationsupplementary information
DOI: 10.1038/ncb2116 Figure S1 CDK phosphorylation of EZH2 in cells. (a) Comparison of candidate CDK phosphorylation sites on EZH2 with known CDK substrates by multiple sequence alignments. (b) CDK1 and
More informationSarker et al. Supplementary Material. Subcellular Fractionation
Supplementary Material Subcellular Fractionation Transfected 293T cells were harvested with phosphate buffered saline (PBS) and centrifuged at 2000 rpm (500g) for 3 min. The pellet was washed, re-centrifuged
More informationFigure S1 is related to Figure 1B, showing more details of outer segment of
Supplemental Information Supplementary Figure legends and Figures Figure S1. Electron microscopic images in Sema4A +/+ and Sema4A / retinas Figure S1 is related to Figure 1B, showing more details of outer
More informationT H E J O U R N A L O F C E L L B I O L O G Y
T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Han et al., http://www.jcb.org/cgi/content/full/jcb.201311007/dc1 Figure S1. SIVA1 interacts with PCNA. (A) HEK293T cells were transiently
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION Supplementary Figure 1 Effect of ROCK inhibition on lumen abnormality in MDCK cysts. (A) MDCK cells as indicated cultured in Matrigel were treated with and without Y27632 (10
More informationSUPPLEMENTARY INFORMATION
DOI:.38/ncb327 a b Sequence coverage (%) 4 3 2 IP: -GFP isoform IP: GFP IP: -GFP IP: GFP Sequence coverage (%) 4 3 2 IP: -GFP IP: GFP 33 52 58 isoform 2 33 49 47 IP: Control IP: Peptide Sequence Start
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/9/429/ra54/dc1 Supplementary Materials for Dephosphorylation of the adaptor LAT and phospholipase C by SHP-1 inhibits natural killer cell cytotoxicity Omri Matalon,
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2386 Figure 1 Src-containing puncta are not focal adhesions, podosomes or endosomes. (a) FAK-/- were stained with anti-py416 Src (green) and either (in red) the focal adhesion protein paxillin,
More informationRecruitment of Grb2 to surface IgG and IgE provides antigen receptor-intrinsic costimulation to class-switched B cells
SUPPLEMENTARY FIGURES Recruitment of Grb2 to surface IgG and IgE provides antigen receptor-intrinsic costimulation to class-switched B cells Niklas Engels, Lars Morten König, Christina Heemann, Johannes
More informationSupplementary Information
Supplementary Information Supplementary Figure 1: Over-expression of CD300f in NIH3T3 cells enhances their capacity to phagocytize AC. (a) NIH3T3 cells were stably transduced by EV, CD300f WT or CD300f
More informationXu et al., Supplementary Figures 1-7
Xu et al., Supplementary Figures 1-7 Supplementary Figure 1. PIPKI is required for ciliogenesis. (a) PIPKI localizes at the basal body of primary cilium. RPE-1 cells treated with two sirnas targeting to
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/4/167/ra20/dc1 Supplementary Materials for Poly(ADP-Ribose) (PAR) Binding to Apoptosis-Inducing Factor Is Critical for PAR Polymerase-1 Dependent Cell Death (Parthanatos)
More informationThis is the author's accepted version of the manuscript.
This is the author's accepted version of the manuscript. The definitive version is published in Nature Communications Online Edition: 2015/4/16 (Japan time), doi:10.1038/ncomms7780. The final version published
More informationSupplementary Fig. 1. (A) Working model. The pluripotency transcription factor OCT4
SUPPLEMENTARY FIGURE LEGENDS Supplementary Fig. 1. (A) Working model. The pluripotency transcription factor OCT4 directly up-regulates the expression of NIPP1 and CCNF that together inhibit protein phosphatase
More informationT H E J O U R N A L O F C E L L B I O L O G Y
T H E J O U R N A L O F C E L L B I O L O G Y Supplemental material Bays et al., http://www.jcb.org/cgi/content/full/jcb.201309092/dc1 Figure S1. Specificity of the phospho-y822 antibody. (A) Total cell
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/8/404/ra120/dc1 Supplementary Materials for The subcellular localization and activity of cortactin is regulated by acetylation and interaction with Keap1 Akihiro
More informationSupplementary Figure 1. GST pull-down analysis of the interaction of GST-cIAP1 (A, B), GSTcIAP1
Legends Supplementary Figure 1. GST pull-down analysis of the interaction of GST- (A, B), GST mutants (B) or GST- (C) with indicated proteins. A, B, Cell lysate from untransfected HeLa cells were loaded
More informationSupplementary Materials and Methods
Supplementary Materials and Methods sirna sequences used in this study The sequences of Stealth Select RNAi for ALK and FLOT-1 were as follows: ALK sense no.1 (ALK): 5 -AAUACUGACAGCCACAGGCAAUGUC-3 ; ALK
More informationSupplemental Data. Wu et al. (2). Plant Cell..5/tpc RGLG Hormonal treatment H2O B RGLG µm ABA µm ACC µm GA Time (hours) µm µm MJ µm IA
Supplemental Data. Wu et al. (2). Plant Cell..5/tpc..4. A B Supplemental Figure. Immunoblot analysis verifies the expression of the AD-PP2C and BD-RGLG proteins in the Y2H assay. Total proteins were extracted
More informationSUPPLEMENTARY INFORMATION
SUPPLEMENTARY INFORMATION Supplementary figures Supplementary Figure 1: Suv39h1, but not Suv39h2, promotes HP1α sumoylation in vivo. In vivo HP1α sumoylation assay. Top: experimental scheme. Middle: we
More informationFigure S1. Sequence alignments of ATRIP and ATR TopBP1 interacting regions.
A H. sapiens 204 TKLQTS--ERANKLAAPSVSH VSPRKNPSVVIKPEACS-PQFGKTSFPTKESFSANMS LP 259 B. taurus 201 TKLQSS--ERANKLAVPTVSH VSPRKSPSVVIKPEACS-PQFGKPSFPTKESFSANKS LP 257 M. musculus 204 TKSQSN--GRTNKPAAPSVSH
More informationFlag-Rac Vector V12 V12 N17 C40. Vector C40 pakt (T308) Akt1. Myc-DN-PAK1 (N-SP)
a b FlagRac FlagRac V2 V2 N7 C4 V2 V2 N7 C4 p (T38) p (S99, S24) p Flag (Rac) NIH 3T3 COS c +Serum p (T38) MycDN (NSP) Mycp27 3 6 2 3 6 2 3 6 2 min p Myc ( or p27) Figure S (a) Effects of Rac mutants on
More informationStargazin regulates AMPA receptor trafficking through adaptor protein. complexes during long term depression
Supplementary Information Stargazin regulates AMPA receptor trafficking through adaptor protein complexes during long term depression Shinji Matsuda, Wataru Kakegawa, Timotheus Budisantoso, Toshihiro Nomura,
More informationSupplementary Figure S1. N-terminal fragments of LRRK1 bind to Grb2.
Myc- HA-Grb2 Mr(K) 105 IP HA 75 25 105 1-1163 1-595 - + - + - + 1164-1989 Blot Myc HA total lysate 75 25 Myc HA Supplementary Figure S1. N-terminal fragments of bind to Grb2. COS7 cells were cotransfected
More informationSupplemental Figure Legends:
Supplemental Figure Legends: Fig S1. GFP-ABRO1 localization. U2OS cells were infected with retrovirus expressing GFP- ABRO1. The cells were fixed with 3.6% formaldehyde and stained with antibodies against
More informationSupplementary information
Supplementary information Identification of E-cadherin signature sites functioning as cleavage sites for Helicobacter pylori HtrA Thomas P. Schmidt 1*, Anna M. Perna 2*, Tim Fugmann 3, Manja Böhm 4, Jan
More informationSupplementary Figure 1. TSA (10 nmol/l), non-class-selective HDAC inhibitor, potentiates
Supplementary Figure 1. TSA (10 nmol/l), non-class-selective HDAC inhibitor, potentiates vascular calcification (VC). (a) Von Kossa staining shows that TSA potentiated the Pi-induced VC. Scale bar, 100
More informationGFP CCD2 GFP IP:GFP
D1 D2 1 75 95 148 178 492 GFP CCD1 CCD2 CCD2 GFP D1 D2 GFP D1 D2 Beclin 1 IB:GFP IP:GFP Supplementary Figure 1: Mapping domains required for binding to HEK293T cells are transfected with EGFP-tagged mutant
More informationSupplementary Fig. 1 Proteomic analysis of ATR-interacting proteins. ATR, ARID1A and
Supplementary Figure Legend: Supplementary Fig. 1 Proteomic analysis of ATR-interacting proteins. ATR, ARID1A and ATRIP protein peptides identified from our mass spectrum analysis were shown. Supplementary
More informationQuantitative analysis of Bidirectional Signaling (qbids)
Quantitative analysis of Bidirectional Signaling (qbids) EphB2 + cells were labeled independently with light (C 12 N 14 ) arginine and lysine or heavy (C 13 N 15 ) arginine and lysine ephrin-b1 + cells
More informationSUPPLEMENTARY INFORMATION
doi:10.1038/nature11070 Supplementary Figure 1 Purification of FLAG-tagged proteins. a, Purification of FLAG-RNF12 by FLAG-affinity from nuclear extracts of wild-type (WT) and two FLAG- RNF12 transgenic
More informationSUPPLEMENTARY INFORMATION
DOI: 10.1038/ncb2743 Figure S1 stabilizes cellular protein level, post-transcriptionally. (a, b) and DDR1 were RNAi-depleted from HEK.293.-CBG cells. Western blots with indicated antibodies (a). RT-PCRs
More informationSUPPLEMENTARY INFORMATION
doi: 10.1038/nature06147 SUPPLEMENTARY INFORMATION Figure S1 The genomic and domain structure of Dscam. The Dscam gene comprises 24 exons, encoding a signal peptide (SP), 10 IgSF domains, 6 fibronectin
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/3/146/ra80/dc1 Supplementary Materials for DNMT1 Stability Is Regulated by Proteins Coordinating Deubiquitination and Acetylation-Driven Ubiquitination Zhanwen
More informationNature Biotechnology: doi: /nbt Supplementary Figure 1
Supplementary Figure 1 Schematic and results of screening the combinatorial antibody library for Sox2 replacement activity. A single batch of MEFs were plated and transduced with doxycycline inducible
More informationSupplementary Information
Supplementary Information Peroxiredoxin-2 and STAT3 form a redox relay for H 2 O 2 signaling Mirko C. Sobotta 1, Willy Liou 1, Sarah Stöcker 1, Deepti Talwar 1, Michael Oehler 1, Thomas Ruppert 2, Annette
More informationSupplementary Figure 1 Collision-induced dissociation (CID) mass spectra of peptides from PPK1, PPK2, PPK3 and PPK4 respectively.
Supplementary Figure 1 lision-induced dissociation (CID) mass spectra of peptides from PPK1, PPK, PPK3 and PPK respectively. % of nuclei with signal / field a 5 c ppif3:gus pppk1:gus 0 35 30 5 0 15 10
More informationSupplementary Information. A novel human endogenous retroviral protein inhibits cell-cell fusion. Supplementary Figures:
Supplementary Information A novel human endogenous retroviral protein inhibits cell-cell fusion Jun Sugimoto, Makiko Sugimoto, Helene Bernstein, Yoshihiro Jinno and Danny J. Schust Supplementary Figures:
More informationSupplementary Fig. 1. Multiple five micron sections of liver tissues of rats treated
Supplementary Figure Legends Supplementary Fig. 1. Multiple five micron sections of liver tissues of rats treated with either vehicle (left; n=3) or CCl 4 (right; n=3) were co-immunostained for NRP-1 (green)
More informationTohru; Kinjo, Masataka; Taru, Hidenori; Suzuki, Tosh. WoS_67871_Suzuki_Supplemental_Materials.pdf (Supplem. Instructions for use
Title Quantitative analysis of APP axonal transport in neu Chiba, Kyoko; Araseki, Masahiko; Nozawa, Keisuke; Fu Author(s) Tadashi; Hata, Saori; Saito, Yuhki; Uchida, Seiichi; Tohru; Kinjo, Masataka; Taru,
More informationHEAHKFLKVEFPARVRSSQATYEIQFGHLQRPTHYNTSWDWARFEVWAHRWMDLSEHGFG Sbjct: 805 HEAHKFLKVEFPARVRSSQATYEIQFGHLQRPTHYNTSWDWARFEVWAHRWMDLSEHGFG 864
Supplementary Fig S1 a gi 27923805 sp Q9NTJ4 MAN2C1HUMAN Alpha-mannosidase 2C1 (Alpha-D-mannoside mannohydrolase) (Mannosidase alpha class 2C member 1) (Alpha mannosidase 6A8B) Query: 1 HEAHKFLKVEFPARVRSSQATYEIQFGHLQRPTHYNTSWDWARFEVWAHRWMDLSEHGFG
More informationFigure S1. Verification of ihog Mutation by Protein Immunoblotting Figure S2. Verification of ihog and boi
Figure S1. Verification of ihog Mutation by Protein Immunoblotting Extracts from S2R+ cells, embryos, and adults were analyzed by immunoprecipitation and immunoblotting with anti-ihog antibody. The Ihog
More informationSupplementary data. sienigma. F-Enigma F-EnigmaSM. a-p53
Supplementary data Supplemental Figure 1 A sienigma #2 sienigma sicontrol a-enigma - + ++ - - - - - - + ++ - - - - - - ++ B sienigma F-Enigma F-EnigmaSM a-flag HLK3 cells - - - + ++ + ++ - + - + + - -
More informationSupplementary Fig.1 Luton
Supplementary Fig.1 Luton a 175 Brain Thymus Spleen Small Intestine Kidney Testis HeLa b 250 Lung Kidney MDCK c EFA6B si Control si Mismatch #637 #1564 #1770 83 62 47.5 175 IB: anti-efa6b #B1 130 66 Lysates
More informationSupplementary Figure 1 Structural modeling and purification of V. cholerae ABH. (a) The migration of the purified rabh and catalytically inactive
Supplementary Figure 1 Structural modeling and purification of V. cholerae ABH. (a) The migration of the purified rabh and catalytically inactive variants rabhs, rabhd, and rabhh are shown on 12% SDS-PAGE
More informationChapter One. Construction of a Fluorescent α5 Subunit. Elucidation of the unique contribution of the α5 subunit is complicated by several factors
4 Chapter One Construction of a Fluorescent α5 Subunit The significance of the α5 containing nachr receptor (α5* receptor) has been a challenging question for researchers since its characterization by
More informationSupplementary Fig. 1. Schematic structure of TRAIP and RAP80. The prey line below TRAIP indicates bait and the two lines above RAP80 highlight the
Supplementary Fig. 1. Schematic structure of TRAIP and RAP80. The prey line below TRAIP indicates bait and the two lines above RAP80 highlight the prey clones identified in the yeast two hybrid screen.
More informationSUPPLEMENTARY INFORMATION
doi: 10.1038/nature06721 SUPPLEMENTARY INFORMATION. Supplemental Figure Legends Supplemental Figure 1 The distribution of hatx-1[82q] in Cos7 cells. Cos7 cells are co-transfected with hatx-1[82q]-gfp (green)
More informationBcl-2 family member Bcl-G is not a pro-apoptotic BH3-only protein
Bcl-2 family member Bcl-G is not a pro-apoptotic BH3-only protein Maybelline Giam 1,2, Toru Okamoto 1,2,3, Justine D. Mintern 1,2,4, Andreas Strasser 1,2 and Philippe Bouillet 1, 2 1 The Walter and Eliza
More informationSupplementary Fig. 1 Kinetics of appearence of the faster migrating form of Bcl-10.
α-cd3 + α-cd28: Time (min): + + + + + + + + + 0 5 15 30 60 120 180 240 300 360 360 n.s. Supplementary Fig. 1 Kinetics of appearence of the faster migrating form of. Immunoblot of lysates from Jurkat cells
More informationTime allowed: 2 hours Answer ALL questions in Section A, ALL PARTS of the question in Section B and ONE question from Section C.
UNIVERSITY OF EAST ANGLIA School of Biological Sciences Main Series UG Examination 2017-18 CELL BIOLOGY BIO-5005B Time allowed: 2 hours Answer ALL questions in Section A, ALL PARTS of the question in Section
More informationSupplementary Materials for
www.sciencesignaling.org/cgi/content/full/6/304/ra104/dc1 Supplementary Materials for Lysine Methylation Promotes VEGFR-2 Activation and Angiogenesis Edward J. Hartsough, Rosana D. Meyer, Vipul Chitalia,
More informationRegulation of transcription by the MLL2 complex and MLL complex-associated AKAP95
Supplementary Information Regulation of transcription by the complex and MLL complex-associated Hao Jiang, Xiangdong Lu, Miho Shimada, Yali Dou, Zhanyun Tang, and Robert G. Roeder Input HeLa NE IP lot:
More informationSupplementary Figure 1. Localization of MST1 in RPE cells. Proliferating or ciliated HA- MST1 expressing RPE cells (see Fig. 5b for establishment of
Supplementary Figure 1. Localization of MST1 in RPE cells. Proliferating or ciliated HA- MST1 expressing RPE cells (see Fig. 5b for establishment of the cell line) were immunostained for HA, acetylated
More informationSupplementary Materials
Supplementary Materials Supplementary Figure 1. PKM2 interacts with MLC2 in cytokinesis. a, U87, U87/EGFRvIII, and HeLa cells in cytokinesis were immunostained with DAPI and an anti-pkm2 antibody. Thirty
More informationSupplementary information
Supplementary information The E3 ligase RNF8 regulates KU80 removal and NHEJ repair Lin Feng 1, Junjie Chen 1 1 Department of Experimental Radiation Oncology, The University of Texas M. D. Anderson Cancer
More informationsupplementary information
DOI: 10.1038/ncb2172 Figure S1 p53 regulates cellular NADPH and lipid levels via inhibition of G6PD. (a) U2OS cells stably expressing p53 shrna or a control shrna were transfected with control sirna or
More informationAt E17.5, the embryos were rinsed in phosphate-buffered saline (PBS) and immersed in
Supplementary Materials and Methods Barrier function assays At E17.5, the embryos were rinsed in phosphate-buffered saline (PBS) and immersed in acidic X-gal mix (100 mm phosphate buffer at ph4.3, 3 mm
More informationSupplementary Materials for
advances.sciencemag.org/cgi/content/full/4/9/eaat5401/dc1 Supplementary Materials for GLK-IKKβ signaling induces dimerization and translocation of the AhR-RORγt complex in IL-17A induction and autoimmune
More informationSupplemental Information. Pacer Mediates the Function of Class III PI3K. and HOPS Complexes in Autophagosome. Maturation by Engaging Stx17
Molecular Cell, Volume 65 Supplemental Information Pacer Mediates the Function of Class III PI3K and HOPS Complexes in Autophagosome Maturation by Engaging Stx17 Xiawei Cheng, Xiuling Ma, Xianming Ding,
More informationCD93 and dystroglycan cooperation in human endothelial cell adhesion and migration
/, Supplementary Advance Publications Materials 2016 CD93 and dystroglycan cooperation in human endothelial cell adhesion and migration Supplementary Materials Supplementary Figure S1: In ECs CD93 silencing
More informationA plot of viable bacterial cell count (CFU/ml) against the OD 600 reading based
RESULTS 4.1 H. pylori and MKN28 cells 4.1.1 H. pylori 4.1.1.1 Enumeration of H. pylori A plot of viable bacterial cell count (CFU/ml) against the OD 600 reading based on different dilutions of a 3-day-old
More informationsupplementary information
Figure S1 ZEB1 full length mrna. (a) Analysis of the ZEB1 mrna using the UCSC genome browser (http://genome.ucsc.edu) revealed truncation of the annotated Refseq sequence (NM_030751). The probable terminus
More informationSupplementary Information. A superfolding Spinach2 reveals the dynamic nature of. trinucleotide repeat RNA
Supplementary Information A superfolding Spinach2 reveals the dynamic nature of trinucleotide repeat RNA Rita L. Strack 1, Matthew D. Disney 2 & Samie R. Jaffrey 1 1 Department of Pharmacology, Weill Medical
More informationSupplemental Table 1 Primers used in study. Human. Mouse
Supplemental Table 1 Primers used in study Human Forward primer region(5-3 ) Reverse primer region(5-3 ) RT-PCR GAPDH gagtcaacggatttggtcgt ttgattttggagggatctcg Raftlin atgggttgcggattgaacaagttaga ctgaggtataacaccaacgaatttcaggc
More informationSUPPLEMENTARY INFORMATION
Ca 2+ /calmodulin Regulates Salicylic Acid-mediated Plant Immunity Liqun Du, Gul S. Ali, Kayla A. Simons, Jingguo Hou, Tianbao Yang, A.S.N. Reddy and B. W. Poovaiah * *To whom correspondence should be
More informationSupplementary Information
Supplementary Information MED18 interaction with distinct transcription factors regulates plant immunity, flowering time and responses to hormones Supplementary Figure 1. Diagram showing T-DNA insertion
More informationSupplementary Information for. Regulation of Rev1 by the Fanconi Anemia Core Complex
Supplementary Information for Regulation of Rev1 by the Fanconi Anemia Core Complex Hyungjin Kim, Kailin Yang, Donniphat Dejsuphong, Alan D. D Andrea* *Corresponding Author: Alan D. D Andrea, M.D. Alan_dandrea@dfci.harvard.edu
More informationMethanol fixation allows better visualization of Kal7. To compare methods for
Supplementary Data Methanol fixation allows better visualization of Kal7. To compare methods for visualizing Kal7 in dendrites, mature cultures of dissociated hippocampal neurons (DIV21) were fixed with
More informationENCODE RBP Antibody Characterization Guidelines
ENCODE RBP Antibody Characterization Guidelines Approved on November 18, 2016 Background An integral part of the ENCODE Project is to characterize the antibodies used in the experiments. This document
More informationSupplementary Figure 1. Drawing of spinal cord open-book preparations and DiI tracing. Nature Neuroscience: doi: /nn.3893
Supplementary Figure 1 Drawing of spinal cord open-book preparations and DiI tracing. Supplementary Figure 2 In ovo electroporation of dominant-negative PlexinA1 in commissural neurons induces midline
More informationSupplemental Material Igreja and Izaurralde 1. CUP promotes deadenylation and inhibits decapping of mrna targets. Catia Igreja and Elisa Izaurralde
Supplemental Material Igreja and Izaurralde 1 CUP promotes deadenylation and inhibits decapping of mrna targets Catia Igreja and Elisa Izaurralde Supplemental Materials and methods Functional assays and
More informationSupplementary Figure 1. α-synuclein is truncated in PD and LBD brains. Nature Structural & Molecular Biology: doi: /nsmb.
Supplementary Figure 1 α-synuclein is truncated in PD and LBD brains. (a) Specificity of anti-n103 antibody. Anti-N103 antibody was coated on an ELISA plate and different concentrations of full-length
More informationColeman et al., Supplementary Figure 1
Coleman et al., Supplementary Figure 1 BrdU Merge G1 Early S Mid S Supplementary Figure 1. Sequential destruction of CRL4 Cdt2 targets during the G1/S transition. HCT116 cells were synchronized by sequential
More informationSupplemental Figure 1
Supplemental Fig. 1. Kinetics of,,, AKT and ERK activation in BMMCs following SCF stimulation. Starved BMMCs were stimulated with 250ng/mL of SCF for the indicated time. Soluble Cell Lysates (SCLs) were
More informationGrowth factor, augmenter of liver regeneration
Supplemental Table 1: Human and mouse PC1 sequence equivalencies Human Mouse Domain Clinical significance; Score* PolyPhen prediction; PSIC score difference C210G C210G WSC Highly likely pathogenic; 15
More informationSupplementary Figure 1. jmj30-2 and jmj32-1 produce null mutants. (a) Schematic drawing of JMJ30 and JMJ32 genome structure showing regions amplified
Supplementary Figure 1. jmj30-2 and jmj32-1 produce null mutants. (a) Schematic drawing of JMJ30 and JMJ32 genome structure showing regions amplified by primers used for mrna expression analysis. Gray
More informationSupplement Figure S1:
Supplement Figure S1: A, Sequence of Xcadherin-11 Morpholino 1 (Xcad-11MO) and 2 (Xcad-11 MO2) and control morpholino in comparison to the Xcadherin-11 sequence. The Xcad-11MO binding sequence spans the
More information