Figure S1. sporulation frequency (%) 80. sme2-5. sme2-3. sme2

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Dynamic Phosphorylation of HP1 Regulates Mitotic Progression in Human Cells Supplementary Figures Supplementary Figure 1. NDR1 interacts with HP1. (a) Immunoprecipitation using

Cdc42 Explores the Cell Periphery for Mate Selection in Fission Yeast

Current Biology, Volume 23 Supplemental Information Cdc42 Explores the Cell Periphery for Mate Selection in Fission Yeast Felipe O. Bendezú and Sophie G. Martin 1 2 Figure S1 (Related to Figure 1). Cells

The Human Protein PRR14 Tethers Heterochromatin to the Nuclear Lamina During Interphase and Mitotic Exit

Cell Reports, Volume 5 Supplemental Information The Human Protein PRR14 Tethers Heterochromatin to the Nuclear Lamina During Interphase and Mitotic Exit Andrey Poleshko, Katelyn M. Mansfield, Caroline

Supplementary information, Figure S1

Supplementary information, Figure S1 (A) Schematic diagram of the sgrna and hspcas9 expression cassettes in a single binary vector designed for Agrobacterium-mediated stable transformation of Arabidopsis

Caroline Lemieux, Samuel Marguerat, Jennifer Lafontaine, Nicolas Barbezier, Jürg Bähler, and Francois Bachand

Molecular Cell, Volume 44 Supplemental Information A Pre-mRNA Degradation Pathway that Selectively Targets Intron-Containing Genes Requires the Nuclear Poly(A)-Binding Protein Caroline Lemieux, Samuel

Alternative Cleavage and Polyadenylation of RNA

Developmental Cell 18 Supplemental Information The Spen Family Protein FPA Controls Alternative Cleavage and Polyadenylation of RNA Csaba Hornyik, Lionel C. Terzi, and Gordon G. Simpson Figure S1, related

Supplemental Figure 1. Mutation in NLA Causes Increased Pi Uptake Activity and

Supplemental Figure 1. Mutation in NLA Causes Increased Pi Uptake Activity and PHT1 Protein Amounts. (A) Shoot morphology of 19-day-old nla mutants under Pi-sufficient conditions. (B) [ 33 P]Pi uptake

Supplementary Figures Montero et al._supplementary Figure 1

Montero et al_suppl. Info 1 Supplementary Figures Montero et al._supplementary Figure 1 Montero et al_suppl. Info 2 Supplementary Figure 1. Transcripts arising from the structurally conserved subtelomeres

7.17: Writing Up Results and Creating Illustrations

7.17: Writing Up Results and Creating Illustrations A Results Exercise: Kansas and Pancakes Write a 5-sentence paragraph describing the results illustrated in this figure: - Describe the figure: highlights?

Figure S1. Figure S2. Figure S3 HB Anti-FSP27 (COOH-terminal peptide) Ab. Anti-GST-FSP27(45-127) Ab.

/ 36B4 mrna ratio Figure S1 * 2. 1.6 1.2.8 *.4 control TNFα BRL49653 Figure S2 Su bw AT p iw Anti- (COOH-terminal peptide) Ab Blot : Anti-GST-(45-127) Ab β-actin Figure S3 HB2 HW AT BA T Figure S4 A TAG

Heme utilization in the Caenorhabditis elegans hypodermal cells is facilitated by hemeresponsive

Supplemental Data Heme utilization in the Caenorhabditis elegans hypodermal cells is facilitated by hemeresponsive gene-2 Caiyong Chen 1, Tamika K. Samuel 1, Michael Krause 2, Harry A. Dailey 3, and Iqbal

Supplementary Figure 1 qrt-pcr expression analysis of NLP8 with and without KNO 3 during germination.

Supplementary Figure 1 qrt-pcr expression analysis of NLP8 with and without KNO 3 during germination. Seeds of Col-0 were harvested from plants grown at 16 C, stored for 2 months, imbibed for indicated

GM130 Is Required for Compartmental Organization of Dendritic Golgi Outposts

Current Biology, Volume 24 Supplemental Information GM130 Is Required for Compartmental Organization of Dendritic Golgi Outposts Wei Zhou, Jin Chang, Xin Wang, Masha G. Savelieff, Yinyin Zhao, Shanshan

Nature Methods: doi: /nmeth Supplementary Figure 1. Retention of RNA with LabelX.

Supplementary Figure 1 Retention of RNA with LabelX. (a) Epi-fluorescence image of single molecule FISH (smfish) against GAPDH on HeLa cells expanded without LabelX treatment. (b) Epi-fluorescence image

A subclass of HSP70s regulate development and abiotic stress responses in Arabidopsis thaliana

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 Journal of Plant Research A subclass of HSP70s regulate development and abiotic stress responses in Arabidopsis thaliana Linna Leng 1 Qianqian Liang

THE centromere is a specific chromosomal locus that organizes

HIGHLIGHTED ARTICLE INVESTIGATION Ectopic Centromere Nucleation by CENP-A in Fission Yeast Marlyn Gonzalez, Haijin He, Qianhua Dong, Siyu Sun, and Fei Li 1 Department of Biology, New York University, New

Supplementary Information

Journal : Nature Biotechnology Supplementary Information Targeted genome engineering in human cells with RNA-guided endonucleases Seung Woo Cho, Sojung Kim, Jong Min Kim, and Jin-Soo Kim* National Creative

DNA supercoiling, a critical signal regulating the basal expression of the lac operon in Escherichia coli

Supplementary Information DNA supercoiling, a critical signal regulating the basal expression of the lac operon in Escherichia coli Geraldine Fulcrand 1,2, Samantha Dages 1,2, Xiaoduo Zhi 1,2, Prem Chapagain

A CRISPR/Cas9 Vector System for Tissue-Specific Gene Disruption in Zebrafish

Developmental Cell Supplemental Information A CRISPR/Cas9 Vector System for Tissue-Specific Gene Disruption in Zebrafish Julien Ablain, Ellen M. Durand, Song Yang, Yi Zhou, and Leonard I. Zon % larvae

Short hairpin RNA (shrna) against MMP14. Lentiviral plasmids containing shrna

Supplemental Materials and Methods Short hairpin RNA (shrna) against MMP14. Lentiviral plasmids containing shrna (Mission shrna, Sigma) against mouse MMP14 were transfected into HEK293 cells using FuGene6

SUPPLEMENTARY INFORMATION

SUPPLEMENTARY INFORMATION Legends for Supplementary Tables. Supplementary Table 1. An excel file containing primary screen data. Worksheet 1, Normalized quantification data from a duplicated screen: valid

Supplemental Data. Regulating Gene Expression. through RNA Nuclear Retention

Supplemental Data Regulating Gene Expression through RNA Nuclear Retention Kannanganattu V. Prasanth, Supriya G. Prasanth, Zhenyu Xuan, Stephen Hearn, Susan M. Freier, C. Frank Bennett, Michael Q. Zhang,

Figure S1. gfp tola and pal mcherry can complement deletion mutants of tola and pal respectively. (A)When strain LS4522 was grown in the presence of

Figure S1. gfp tola and pal mcherry can complement deletion mutants of tola and pal respectively. (A)When strain LS4522 was grown in the presence of xylose, inducing expression of gfp-tola, localization

Supplemental Information. Boundary Formation through a Direct. Threshold-Based Readout. of Mobile Small RNA Gradients

Developmental Cell, Volume 43 Supplemental Information Boundary Formation through a Direct Threshold-Based Readout of Mobile Small RNA Gradients Damianos S. Skopelitis, Anna H. Benkovics, Aman Y. Husbands,

Confocal immunofluorescence microscopy

Confocal immunofluorescence microscopy HL-6 and cells were cultured and cytospun onto glass slides. The cells were double immunofluorescence stained for Mt NPM1 and fibrillarin (nucleolar marker). Briefly,

Supplemental Material for Xue et al. List. Supplemental Figure legends. Figure S1. Related to Figure 1. Figure S2. Related to Figure 3

Supplemental Material for Xue et al List Supplemental Figure legends Figure S1. Related to Figure 1 Figure S. Related to Figure 3 Figure S3. Related to Figure 4 Figure S4. Related to Figure 4 Figure S5.

SUPPLEMENTARY INFORMATION FOR SELA ET AL., Neddylation and CAND1 independently stimulate SCF ubiquitin ligase activity in Candida albicans

SUPPLEMENTARY INFORMATION FOR SELA ET AL., Neddylation and CAND1 independently stimulate SCF ubiquitin ligase activity in Candida albicans Supplementary methods Plasmids and strains construction CaRUB1

Contents... vii. List of Figures... xii. List of Tables... xiv. Abbreviatons... xv. Summary... xvii. 1. Introduction In vitro evolution...

vii Contents Contents... vii List of Figures... xii List of Tables... xiv Abbreviatons... xv Summary... xvii 1. Introduction...1 1.1 In vitro evolution... 1 1.2 Phage Display Technology... 3 1.3 Cell surface

Learning Objectives. Define RNA interference. Define basic terminology. Describe molecular mechanism. Define VSP and relevance

Learning Objectives Define RNA interference Define basic terminology Describe molecular mechanism Define VSP and relevance Describe role of RNAi in antigenic variation A Nobel Way to Regulate Gene Expression

Watson BM Gene Capitolo 11 Watson et al., BIOLOGIA MOLECOLARE DEL GENE, Zanichelli editore S.p.A. ? Le proteine della trasposizione Watson et al., BIOLOGIA MOLECOLARE DEL GENE, Zanichelli editore S.p.A.

7.06 Problem Set #3, Spring 2005

7.06 Problem Set #3, Spring 2005 1. The Drosophila compound eye is composed of about 800 units called ommatidia. Each ommatidium contains eight photoreceptor neurons (R1 through R8), which develop in a

Supplemental Materials. Matrix Proteases Contribute to Progression of Pelvic Organ Prolapse in Mice and Humans

Supplemental Materials Matrix Proteases Contribute to Progression of Pelvic Organ Prolapse in Mice and Humans Madhusudhan Budatha, Shayzreen Roshanravan, Qian Zheng, Cecilia Weislander, Shelby L. Chapman,

Active-Site Mutations in the Xrn1p Exoribonuclease of Saccharomyces cerevisiae Reveal a Specific Role in Meiosis

MOLECULAR AND CELLULAR BIOLOGY, Sept. 1999, p. 5930 5942 Vol. 19, No. 9 0270-7306/99/$04.00 0 Copyright 1999, American Society for Microbiology. All Rights Reserved. Active-Site Mutations in the Xrn1p

Stable mrnp Formation and Export Require Cotranscriptional Recruitment of the mrna Export Factors Yra1p and Sub2p by Hpr1p

MOLECULAR AND CELLULAR BIOLOGY, Dec. 2002, p. 8241 8253 Vol. 22, No. 23 0270-7306/02/$04.00 0 DOI: 10.1128/MCB.22.23.8241 8253.2002 Copyright 2002, American Society for Microbiology. All Rights Reserved.

Analysis of two mitochondrial functions in Saccharomyces cerevisiae

PhD thesis Analysis of two mitochondrial functions in Saccharomyces cerevisiae Zsuzsanna Fekete Supervisors: Gyula Kispál, MD, PhD, Katalin Sipos, MD, PhD University of Pécs Medical School Pécs, 2010 Introduction

Separation of DNA Replication from the Assembly of Break-Competent Meiotic Chromosomes

Separation of DNA Replication from the Assembly of Break-Competent Meiotic Chromosomes Hannah G. Blitzblau 1,2, Clara S. Chan 1, Andreas Hochwagen 2,3, Stephen P. Bell 1 * 1 Department of Biology, Howard

Cryptic Transcription Mediates Repression of Subtelomeric Metal Homeostasis Genes

Cryptic Transcription Mediates Repression of Subtelomeric Metal Homeostasis Genes Isabelle Toesca., Camille R. Nery., Cesar F. Fernandez, Shakir Sayani, Guillaume F. Chanfreau* Department of Chemistry

Transforming Growth Factor -Independent Shuttling of Smad4 between the Cytoplasm and Nucleus

MOLECULAR AND CELLULAR BIOLOGY, Dec. 2000, p. 9041 9054 Vol. 20, No. 23 0270-7306/00/$04.00 0 Copyright 2000, American Society for Microbiology. All Rights Reserved. Transforming Growth Factor -Independent

H3K9me-Independent Gene Silencing in Fission Yeast Heterochromatin by Clr5 and Histone Deacetylases

H3K9me-Independent Gene Silencing in Fission Yeast Heterochromatin by Clr5 and Histone Deacetylases Klavs R. Hansen 1,2, Idit Hazan 3, Sreenath Shanker 4, Stephen Watt 5,6, Janne Verhein-Hansen 1,Jürg

Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table.

Supplementary Table 1. The Q-PCR primer sequence is summarized in the following table. Name Sequence (5-3 ) Application Flag-u ggactacaaggacgacgatgac Shared upstream primer for all the amplifications of

Prions Other molecules besides organelle DNA are inherited in non-mendelian patterns.

Prions Other molecules besides organelle DNA are inherited in non-mendelian patterns. Examples of non-mendelian patterns of inheritance extend beyond the inheritance of organelle DNA. Certain DNA and RNA

TECHNICAL BULLETIN. In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits

In Vitro Bacterial Split Fluorescent Protein Fold n Glow Solubility Assay Kits Catalog Numbers APPA001 In Vitro Bacterial Split GFP "Fold 'n' Glow" Solubility Assay Kit (Green) APPA008 In Vitro Bacterial

RGS Proteins and Septins Cooperate to Promote Chemotropism by Regulating Polar Cap Mobility

Current Biology, Volume 25 Supplemental Information RGS Proteins and Septins Cooperate to Promote Chemotropism by Regulating Polar Cap Mobility Joshua B. Kelley, Gauri Dixit, Joshua B. Sheetz, Sai Phanindra

Supplemental Information. Antagonistic Activities of Sox2. and Brachyury Control the Fate Choice. of Neuro-Mesodermal Progenitors

Developmental Cell, Volume 42 Supplemental Information Antagonistic Activities of Sox2 and Brachyury Control the Fate Choice of Neuro-Mesodermal Progenitors Frederic Koch, Manuela Scholze, Lars Wittler,

Supporting Information

Supporting Information Rougemaille et al. 1.173/pnas.12494719 SI Methods Strain Construction. Homologous replacement of DNA was accomplished by lithium acetate transformation of PCR products containing

SUPPLEMENTAL MATERIALS

SUPPLEMENL MERILS Eh-seq: RISPR epitope tagging hip-seq of DN-binding proteins Daniel Savic, E. hristopher Partridge, Kimberly M. Newberry, Sophia. Smith, Sarah K. Meadows, rian S. Roberts, Mark Mackiewicz,

DICER-LIKE2 Plays a Primary Role in Transitive Silencing of Transgenes in Arabidopsis

DICER-LIKE2 Plays a Primary Role in Transitive Silencing of Transgenes in Arabidopsis Sizolwenkosi Mlotshwa 1, Gail J. Pruss 1, Angela Peragine 2, Matthew W. Endres 1, Junjie Li 3, Xuemei Chen 3, R. Scott

Trasposable elements: Uses of P elements Problem set B at the end

Trasposable elements: Uses of P elements Problem set B at the end P-elements have revolutionized the way Drosophila geneticists conduct their research. Here, we will discuss just a few of the approaches

Supplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling

Supplementary information to accompany: A novel role for the DNA repair gene Rad51 in Netrin-1 signalling Glendining KA 1, Markie D 2, Gardner RJM 4, Franz EA 3, Robertson SP 4, Jasoni CL 1 Supplementary

TECHNICAL BULLETIN. U2OS GFP-NUP98 Osteosarcoma Cell Line with 3XFLAG -GFPtagged. Catalog Number CLL1136 Storage Temperature 196 C (liquid nitrogen)

U2OS GFP-NUP98 Osteosarcoma Cell Line with 3XFLAG -GFPtagged NUP98 Catalog Number CLL1136 Storage Temperature 196 C (liquid nitrogen) TECHNICAL BULLETIN Product Description This product is a human U2OS

TTTCAGGGTCCATAAGATCCTAGGGATAACAGGGTAATAGATCTAAGCTTTTC AATTCA

Supplementary data Materials and methods Strains and plasmids The strains used in this study are listed in supplementary Table 1. Gene deletions were made by PCR-mediated transformation with the pfa6a-skhis3-mx6,

Keiko Ogino and Hisao Masai 1 From the Genome Dynamics Project, Tokyo Metropolitan Institute of Medical Science, Tokyo , Japan

THE JOURNAL OF BIOLOGICAL CHEMISTRY VOL. 281, NO. 3, pp. 1338 1344, January 20, 2006 2006 by The American Society for Biochemistry and Molecular Biology, Inc. Printed in the U.S.A. Rad3-Cds1 Mediates Coupling

Universitaet Regensburg, Institut für Biochemie, Genetik und Mikrobiologie, Regensburg, Germany

Actively transcribed rrna genes in S. cerevisiae are organized in a specialized chromatin associated with the high-mobility group protein Hmo1 and are largely devoid of histone molecules Katharina Merz,

The GeneEditor TM in vitro Mutagenesis System: Site- Directed Mutagenesis Using Altered Beta-Lactamase Specificity

Promega Notes Magazine Number 62, 1997, p. 02 The GeneEditor TM in vitro Mutagenesis System: Site- Directed Mutagenesis Using Altered Beta-Lactamase Specificity By Christine Andrews and Scott Lesley Promega

Supplementary Figure 1: sgrna library generation and the length of sgrnas for the functional screen. (a) A diagram of the retroviral vector for sgrna

Supplementary Figure 1: sgrna library generation and the length of sgrnas for the functional screen. (a) A diagram of the retroviral vector for sgrna expression. It contains a U6-promoter-driven sgrna

Sordaria Lab Report. Sordaria Fimicola reproduce through the process of meiosis. This process entails

Adil Sabir Bio 110H 18 October 2014 Sordaria Lab Report I. Introduction Sordaria Fimicola reproduce through the process of meiosis. This process entails prophase I, metaphase I, anaphase I, telophase I,

Supporting Information

Supporting Information Beauregard et al. 10.1073/pnas.1218984110 Fig. S1. Model depicting the regulatory pathway leading to expression of matrix genes. The master regulator Spo0A can be directly or indirectly

Inhibition of TATA-Binding Protein Function by SAGA Subunits Spt3 and Spt8 at Gcn4-Activated Promoters

MOLECULAR AND CELLULAR BIOLOGY, Jan. 2000, p. 634 647 Vol. 20, No. 2 0270-7306/00/$04.00 0 Copyright 2000, American Society for Microbiology. All Rights Reserved. Inhibition of TATA-Binding Protein Function

Molecular Cell Biology - Problem Drill 11: Recombinant DNA

Molecular Cell Biology - Problem Drill 11: Recombinant DNA Question No. 1 of 10 1. Which of the following statements about the sources of DNA used for molecular cloning is correct? Question #1 (A) cdna

No, because expression of the P elements and hence transposase in suppressed in the F1.

Problem set B 1. A wild-type ry+ (rosy) gene was introduced into a ry mutant using P element-mediated gene transformation, and a strain containing a stable ry+ gene was established. If a transformed male

Product Name : Simple mirna Detection Kit

Product Name : Simple mirna Detection Kit Code No. : DS700 This product is for research use only Kit Contents This kit provides sufficient reagents to perform 20 reactions for detecting microrna. Components

B-Cyclin/CDKs Regulate Mitotic Spindle Assembly by Phosphorylating Kinesins-5 in Budding Yeast

B-Cyclin/CDKs Regulate Mitotic Spindle Assembly by Phosphorylating Kinesins-5 in Budding Yeast Mark K. Chee, Steven B. Haase* Department of Biology, Duke University, Durham, North Carolina, United States

Fig. S1. Nature Medicine: doi: /nm HoxA9 expression levels BM MOZ-TIF2 AML BM. Sca-1-H. c-kit-h CSF1R-H CD16/32-H. Mac1-H.

A 1 4 1 4 1 4 CSF1RH 1 3 1 2 1 1 CSF1RH 1 3 1 2 1 1 CSF1RH 1 3 1 2 1 1 1 1 1 1 1 2 1 3 1 4 GFPH 1 1 1 1 1 2 1 3 1 4 Sca1H 1 1 1 1 1 2 1 3 1 4 ckith 1 4 1 4 1 4 CSF1RH 1 3 1 2 1 1 CSF1RH 1 3 1 2 1 1 CSF1RH

Targeted modification of gene function exploiting homology directed repair of TALENmediated double strand breaks in barley

Targeted modification of gene function exploiting homology directed repair of TALENmediated double strand breaks in barley Nagaveni Budhagatapalli a, Twan Rutten b, Maia Gurushidze a, Jochen Kumlehn a,

1A) What is different about the resulting resection of ends by these two complexes?

MIT Department of Biology 7.28, Spring 2005 - Molecular Biology Question 1. Your lab is studying the MRX complex in S. pombe, otherwise known as fission yeast. For your dissertation work, you are studying

Green Fluorescent Protein. Avinash Bayya Varun Maturi Nikhileswar Reddy Mukkamala Aravindh Subhramani

Green Fluorescent Protein Avinash Bayya Varun Maturi Nikhileswar Reddy Mukkamala Aravindh Subhramani Introduction The Green fluorescent protein (GFP) was first isolated from the Jellyfish Aequorea victoria,

Tension directly stabilizes reconstituted. kinetochore-microtubule attachments

SUPPLEMENTARY INFORMATION Tension directly stabilizes reconstituted kinetochore-microtubule attachments Bungo Akiyoshi, Krishna K. Sarangapani, Andrew F. Powers, Christian R. Nelson, Steve L. Reichow,

Supporting Information. SI Material and Methods

Supporting Information SI Material and Methods RNA extraction and qrt-pcr RNA extractions were done using the classical phenol-chloroform method. Total RNA samples were treated with Turbo DNA-free (Ambion)

Figure S1: NUN preparation yields nascent, unadenylated RNA with a different profile from Total RNA.

Summary of Supplemental Information Figure S1: NUN preparation yields nascent, unadenylated RNA with a different profile from Total RNA. Figure S2: rrna removal procedure is effective for clearing out

The RNA binding protein Npl3 promotes resection of DNA double-strand breaks by regulating the levels of Exo1

6530 6545 Nucleic Acids Research, 2017, Vol. 45, No. 11 Published online 2 May 2017 doi: 10.1093/nar/gkx347 The RNA binding protein Npl3 promotes resection of DNA double-strand breaks by regulating the

Toll Receptor-Mediated Hippo Signaling Controls Innate Immunity in Drosophila

Cell Supplemental Information Toll Receptor-Mediated Hippo Signaling Controls Innate Immunity in Drosophila Bo Liu, Yonggang Zheng, Feng Yin, Jianzhong Yu, Neal Silverman, and Duojia Pan Supplemental Experimental

Impact of Retinoic acid induced-1 (Rai1) on Regulators of Metabolism and Adipogenesis

Impact of Retinoic acid induced-1 (Rai1) on Regulators of Metabolism and Adipogenesis The mammalian system undergoes ~24 hour cycles known as circadian rhythms that temporally orchestrate metabolism, behavior,

A novel two-step genome editing strategy with CRISPR-Cas9 provides new insights into telomerase action and TERT gene expression

Xi et al. Genome Biology (2015) 16:231 DOI 10.1186/s13059-015-0791-1 RESEARCH A novel two-step genome editing strategy with CRISPR-Cas9 provides new insights into telomerase action and TERT gene expression

Immunofluorescence images of different core histones and different histone exchange assay.

Molecular Cell, Volume 51 Supplemental Information Enhanced Chromatin Dynamics by FACT Promotes Transcriptional Restart after UV-Induced DNA Damage Christoffel Dinant, Giannis Ampatziadis-Michailidis,

The fission yeast SPB component Cut12 links bipolar spindle formation to mitotic control

The fission yeast SPB component Cut12 links bipolar spindle formation to mitotic control Alan J. Bridge, Mary Morphew, 1 Rachel Bartlett, 2 and Iain M. Hagan 3 School of Biological Sciences, University

Supplement Figure 1. Characterization of the moab. (A) A series of moabs that are anti-hαiib-specific were tested for their ability to bind to

Supplement Figure 1. Characterization of the 312.8 moab. (A) A series of moabs that are anti-hαiib-specific were tested for their ability to bind to platelets. The black line represents the 312.8 moab

R1 12 kb R1 4 kb R1. R1 10 kb R1 2 kb R1 4 kb R1

Bcor101 Sample questions Midterm 3 1. The maps of the sites for restriction enzyme EcoR1 (R1) in the wild type and mutated cystic fibrosis genes are shown below: Wild Type R1 12 kb R1 4 kb R1 _ _ CF probe

6.2 Chromatin is divided into euchromatin and heterochromatin

6.2 Chromatin is divided into euchromatin and heterochromatin Individual chromosomes can be seen only during mitosis. During interphase, the general mass of chromatin is in the form of euchromatin. Euchromatin

Supplementary Figure 1. Comparison of nodules from Gifu and epr3-9 plants inoculated with M. loti MAFF and incubated at 21 C or 28 C.

Supplementary Figure 1. Comparison of nodules from Gifu and epr3-9 plants inoculated with M. loti MAFF303099 and incubated at 21 C or 28 C. (a to l) are at 21 C, and (m to å) are at 28 C. (a, e, i, m,

Confirming the Phenotypes of E. coli Strains

Confirming the Phenotypes of E. coli Strains INTRODUCTION Before undertaking any experiments, we need to confirm that the phenotypes of the E. coli strains we intend to use in the planned experiments correspond

Analysis of TFIIA Function In Vivo: Evidence for a Role in TATA-Binding Protein Recruitment and Gene-Specific Activation

MOLECULAR AND CELLULAR BIOLOGY, Dec. 1999, p. 8673 8685 Vol. 19, No. 12 0270-7306/99/$04.00 0 Copyright 1999, American Society for Microbiology. All Rights Reserved. Analysis of TFIIA Function In Vivo:

Supplemental Fig. S1. Key to underlines: Key to amino acids:

AspA-F1 AspA 1 MKQMETKGYGYFRKTKAYGLVCGIT--------------LAGALTLGTTSVSADDVTTLNPATNLTTLQTPPTADQTQLAHQAGQQSGELVSEVSNTEWD 86 SspB 1 MQKREV--FG-FRKSKVAKTLCGAV-LGAALIAIADQQVLADEVTETNSTANVAVTTTGNPATNLPEAQGEATEAASQSQAQAGSKDGALPVEVSADDLN

TECHNICAL BULLETIN. GenElute mrna Miniprep Kit. Catalog MRN 10 MRN 70

GenElute mrna Miniprep Kit Catalog Numbers MRN 10, MRN 70 TECHNICAL BULLETIN Product Description The GenElute mrna Miniprep Kit provides a simple and convenient way to purify polyadenylated mrna from previously

The mitotic spindle is required for loading of the DASH complex onto the kinetochore

The mitotic spindle is required for loading of the DASH complex onto the kinetochore Yumei Li, 1 Jeff Bachant, 1 Annette A.Alcasabas, 1 Yanchang Wang, 1 Jun Qin, 1,2 and Stephen J.Elledge 1,3,4,5 1 Verna

Supplemental Data. mir156-regulated SPL Transcription. Factors Define an Endogenous Flowering. Pathway in Arabidopsis thaliana

Cell, Volume 138 Supplemental Data mir156-regulated SPL Transcription Factors Define an Endogenous Flowering Pathway in Arabidopsis thaliana Jia-Wei Wang, Benjamin Czech, and Detlef Weigel Table S1. Interaction

Supplementary Figure 1

Supplementary Figure 1 Supplementary Figure 1: Vector maps of TRMPV and TRMPVIR variants. Many derivatives of TRMPV have been generated and tested. Unless otherwise noted, experiments in this paper use

Supplementary Methods. Plasmid construction. NS5A-fluorophore fusion Jc1 genomes were generated

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 Supplementary Methods Plasmid construction. NS5A-fluorophore fusion Jc1 genomes were generated by introducing a linker containing an XbaI and

Supplemental Data. Distinct Pathways for snorna and mrna Termination

Molecular Cell, Volume 24 Supplemental Data Distinct Pathways for snorna and mrna Termination Minkyu Kim, Lidia Vasiljeva, Oliver J. Rando, Alexander Zhelkovsky, Claire Moore, and Stephen Buratowski A

Summary of Mutagenic Toxicity Test Results for EvaGreen

Summary of Mutagenic Toxicity Test Results for EvaGreen Compiled by Biotium, Inc. from the results of an independent testing service: Litron Laboratories, Inc., Rochester, NY Overview When our scientists

Endoplasmic Reticulum Stress Induction of the Grp78/BiP Promoter: Activating Mechanisms Mediated by YY1 and Its Interactive Chromatin Modifiers

MOLECULAR AND CELLULAR BIOLOGY, June 2005, p. 4529 4540 Vol. 25, No. 11 0270-7306/05/$08.00 0 doi:10.1128/mcb.25.11.4529 4540.2005 Copyright 2005, American Society for Microbiology. All Rights Reserved.

RITS acts in cis to promote RNA interference mediated transcriptional and post-transcriptional silencing

00 Nature Publishing Group http://www.nature.com/naturegenetics RITS acts in cis to promote RNA interference mediated transcriptional and post-transcriptional silencing Ken-ichi Noma, Tomoyasu Sugiyama,

Electronic Supplementary Information

Electronic Supplementary Material (ESI) for Molecular BioSystems. This journal is The Royal Society of Chemistry 2017 Electronic Supplementary Information Dissecting binding of a β-barrel outer membrane

Transcriptional Activation of the General Amino Acid Permease Gene per1 by the Histone Deacetylase Clr6 Is Regulated by Oca2 Kinase

MOLECULAR AND CELLULAR BIOLOGY, July 2010, p. 3396 3410 Vol. 30, No. 13 0270-7306/10/$12.00 doi:10.1128/mcb.00971-09 Copyright 2010, American Society for Microbiology. All Rights Reserved. Transcriptional

Gene Expression Technology

Gene Expression Technology Bing Zhang Department of Biomedical Informatics Vanderbilt University bing.zhang@vanderbilt.edu Gene expression Gene expression is the process by which information from a gene

Center Drive, University of Michigan Health System, Ann Arbor, MI

Leukotriene B 4 -induced reduction of SOCS1 is required for murine macrophage MyD88 expression and NFκB activation Carlos H. Serezani 1,3, Casey Lewis 1, Sonia Jancar 2 and Marc Peters-Golden 1,3 1 Division

Polyadenylation-Dependent Control of Long Noncoding RNA Expression by the Poly(A)-Binding Protein Nuclear 1

Polyadenylation-Dependent Control of Long Noncoding RNA Expression by the Poly(A)-Binding Protein Nuclear 1 Yves B. Beaulieu 1, Claudia L. Kleinman 2, Anne-Marie Landry-Voyer 1, Jacek Majewski 2, François

Problem Set 2B Name and Lab Section:

Problem Set 2B 9-26-06 Name and Lab Section: 1. Define each of the following rearrangements (mutations) (use one phrase or sentence for each). Then describe what kind of chromosomal structure you might

DNA Structure and Properties Basic Properties Predicting Melting Temperature. Dinesh Yadav

DNA Structure and Properties Basic Properties Predicting Melting Temperature Dinesh Yadav Nucleic Acid Structure Question: Is this RNA or DNA? Molecules of Life, pp. 15 2 Nucleic Acid Bases Molecules of

Mechanism of Prion Loss after Hsp104 Inactivation in Yeast

MOLECULAR AND CELLULAR BIOLOGY, July 2001, p. 4656 4669 Vol. 21, No. 14 0270-7306/01/$04.00 0 DOI: 10.1128/MCB.21.14.4656 4669.2001 Copyright 2001, American Society for Microbiology. All Rights Reserved.